Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1095 bp · LXL04_039758|LXL04_039758|OH1004|cDNA
ATGCGGGtggaaaattcaaaattcaaaggAGATACCTGTGGAAAATTCAAAATTTCATCGATCCGTAAACATCCTCCGCTTCTTATAAGCCCTAGATTGAGCCGGCCTCCTTATTTCAAATGGAGATGCGACGGTAACAATATTACCCCTCTCCCAACTTTGCAGATGGCTGGGTTGCTCGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGTCGAAACCACCATCTAGCCGACgatttcttttcttctcc...
1095 bp · LXL04_039758|LXL04_039758|OH1004|CDS
ATGCGGGTGGAAAATTCAAAATTCAAAGGAGATACCTGTGGAAAATTCAAAATTTCATCGATCCGTAAACATCCTCCGCTTCTTATAAGCCCTAGATTGAGCCGGCCTCCTTATTTCAAATGGAGATGCGACGGTAACAATATTACCCCTCTCCCAACTTTGCAGATGGCTGGGTTGCTCGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGTCGAAACCACCATCTAGCCGACGATTTCTTTTCTTCTCC...
Protein
Download Protein FASTA364 aa · LXL04_039758|LXL04_039758|OH1004|PROTEIN
MRVENSKFKGDTCGKFKISSIRKHPPLLISPRLSRPPYFKWRCDGNNITPLPTLQMAGLLGCRRGWFFLLVGHRRNHHLADDFFSSPSWCDNLQATTANYFDAYLCMRIDYHVSQINLKSTRNKYAGRMKIDCWVVGCSFGYGYQVRELAEKEDENGIFKLLRTDITRFLTTILIGTTELPPNSKIVATHTDSGPLKGLWKEAVALNELRQSDTSIEYATDFILGNFHVVIKEDDEKSLVAAVAQIIANLEMAKENHETG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_039758 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_039758 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | JAJTUU010000036.1:9361-11687 (-) | |||||||||
| Description | Similar to CBSDUFCH1: Putative DUF21 domain-containing protein At3g13070, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009706 chloroplast inner membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0050660 flavin adenine dinucleotide binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G55930 ath:AT3G13070 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9LK65 | Arabidopsis thaliana | Putative DUF21 domain-containing protein At3g13070, chloroplastic | 77.143% | Swiss-Prot | weak database homology |
Q84R21 | Arabidopsis thaliana | DUF21 domain-containing protein At1g55930, chloroplastic | 77.143% | Swiss-Prot | weak database homology |