LXL04_039561 | RubberDandelionOmics

Gene overview

LXL04_039561

Reference: OH-1004 Chr: JAJTUU010000013.1 Coordinates: 1154655-1155529 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · LXL04_039561|LXL04_039561|OH1004|cDNA

ATGGAGAAGACCAGAAATTCTTTGACACTATGGAACCCTTCGATTAGGCGCAAACTAACCTTGCCTGATTTTCCTCGTAAATTGAAATCATGTTCGGAAGAGTTTGGGTTTGGATACGACCCAATAAGTGATGATTACAAAATTATCCGGATATCGCATGCAAGAGATACTTCACTTTTTTATGCGGTGAAGACAGGCGCTTGGTGTGAGATTGCTTCCCCTAAACTTCTTTGTCTTAATGTGTTACCTCGTCCATGTTC...

CDS

Download CDS FASTA

762 bp · LXL04_039561|LXL04_039561|OH1004|CDS

ATGGAGAAGACCAGAAATTCTTTGACACTATGGAACCCTTCGATTAGGCGCAAACTAACCTTGCCTGATTTTCCTCGTAAATTGAAATCATGTTCGGAAGAGTTTGGGTTTGGATACGACCCAATAAGTGATGATTACAAAATTATCCGGATATCGCATGCAAGAGATACTTCACTTTTTTATGCGGTGAAGACAGGCGCTTGGTGTGAGATTGCTTCCCCTAAACTTCTTTGTCTTAATGTGTTACCTCGTCCATGTTC...

Protein

Download Protein FASTA

253 aa · LXL04_039561|LXL04_039561|OH1004|PROTEIN

MEKTRNSLTLWNPSIRRKLTLPDFPRKLKSCSEEFGFGYDPISDDYKIIRISHARDTSLFYAVKTGAWCEIASPKLLCLNVLPRPCSLEGVLHWSVRYRIESEEMHLTCSILTFNLSTHVFGMIPLPPPTSDWMTTGLTTIQGSLALISYHMKFEDTWIWVRRDFSWSVFCRLNTIRQFIEGAFQLQPQPNNNGYLLLNISGRLPEEVYVYNLKRGELSKVVDFDAASTLRNFCQCVETLRLLDMGETVCETT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039561`
TK1151 ID	TkA04G341270
OH-1004 ID	LXL04_039561
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.900
Protein coverage (%)	TK1151 73.592 / OH-1004 98.419 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039561

Location JAJTUU010000013.1:1154655-1155529 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039561 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference

ath:AT3G16210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · LXL04_039561 · OH-1004

Nucleus0.379

Rank 2 · LXL04_039561 · OH-1004

Cell membrane0.154

Rank 3 · LXL04_039561 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_039561 · OH-1004

Lysosome / Vacuole0.047

Rank 5 · LXL04_039561 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07734.19FBA_14-173 aa

PF08268.18FBA_35-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039561	`PF07734.19`	FBA_1	4	173	5e-13	49.4
LXL04_039561	`PF08268.18`	FBA_3	5	166	1.1e-14	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU24`	Arabidopsis thaliana	Putative F-box protein At3g16210	25.573%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card