Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2355 bp · LXL04_039553|LXL04_039553|OH1004|cDNA
ATGACAAGCTCTCTACTTTGCCAATTCCTGGTCAAATGCAGCCTTGCCAATTCTACTTTGACTTGGATTCTGAACTGGTGTGGTATCCAGGCATCTCAATTTCAGACCGTGGGAGAGTTAATCAGATTTGCTGCCATGTGGGGGAACTGCCCGAAAAAACGCAAAATCCTGCTGGCCATCATCTACGGATCTCTCTGGTGTACGTGGAAGGCAAGAAATGACAAAACTTTCAACAATCGTCGTACAACTACTCCACAGCT...
2355 bp · LXL04_039553|LXL04_039553|OH1004|CDS
ATGACAAGCTCTCTACTTTGCCAATTCCTGGTCAAATGCAGCCTTGCCAATTCTACTTTGACTTGGATTCTGAACTGGTGTGGTATCCAGGCATCTCAATTTCAGACCGTGGGAGAGTTAATCAGATTTGCTGCCATGTGGGGGAACTGCCCGAAAAAACGCAAAATCCTGCTGGCCATCATCTACGGATCTCTCTGGTGTACGTGGAAGGCAAGAAATGACAAAACTTTCAACAATCGTCGTACAACTACTCCACAGCT...
Protein
Download Protein FASTA784 aa · LXL04_039553|LXL04_039553|OH1004|PROTEIN
MTSSLLCQFLVKCSLANSTLTWILNWCGIQASQFQTVGELIRFAAMWGNCPKKRKILLAIIYGSLWCTWKARNDKTFNNRRTTTPQLADNILTLVFSWVKYRGNYGDCKWSEWVCSPFNILVDDIVQTTTITTTSTNSIKLAICFTSSSSSMKISSRSILSPARARDPPPISLSSSRSRKLRNSRSIKGGGASPAMFPTTTGKRRGSGFENPEPSSPKVTCIGQVRVKSKKKQAKNQRCLSRRDVGFRRLEHSGNGFGSQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_039553 |
|---|---|
| TK1151 ID | TkA04G332470 |
| OH-1004 ID | LXL04_039553 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 89.900 |
| Protein coverage (%) | TK1151 98.723 / OH-1004 75.893Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_039553 |
|---|---|
| Location | JAJTUU010000013.1:974613-980887 (-) |
| Description | Similar to PF11_0240: Dynein heavy chain-like protein PF11_0240 (Plasmodium falciparum (isolate 3D7) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007018 microtubule-based movement Biological Process GO:0060294 cilium movement involved in cell motility Biological Process GO:0005874 microtubule Cellular Component GO:0005875 microtubule associated complex Cellular Component GO:0005930 axoneme Cellular Component GO:0030286 dynein complex Cellular Component GO:0097729 9+2 motile cilium Cellular Component GO:0003774 cytoskeletal motor activity Molecular Function GO:0003777 microtubule motor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008569 minus-end-directed microtubule motor activity Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function |
| KEGG gene cross-reference | pfa:PF3D7_1122900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.