Gene Card
Gene overview
cDNA / CDS / Protein Sequences
765 bp · LXL04_039337|LXL04_039337|OH1004|cDNA
ATGCTCTTAATCCATATACTTAGTTCCATAACAAACTCCCCTTTAACTTTGTGCTTTCATCATTGCAAACAGAACAAATTGGGCAGAGGGCACCGTGACAAGGTTCAACAGTTCATGACAATTACTGGTGCAAGTGAAAAAGTTGCTCTTCAAGCCTTAAAGGCAAGTGATTGGCATCTTGATGGAGCATTTGATGTATTCTACAATCCTTATGCTGATATGATTATGGCTGATGGCATTAGCAACCTCTGCAATGACCT...
765 bp · LXL04_039337|LXL04_039337|OH1004|CDS
ATGCTCTTAATCCATATACTTAGTTCCATAACAAACTCCCCTTTAACTTTGTGCTTTCATCATTGCAAACAGAACAAATTGGGCAGAGGGCACCGTGACAAGGTTCAACAGTTCATGACAATTACTGGTGCAAGTGAAAAAGTTGCTCTTCAAGCCTTAAAGGCAAGTGATTGGCATCTTGATGGAGCATTTGATGTATTCTACAATCCTTATGCTGATATGATTATGGCTGATGGCATTAGCAACCTCTGCAATGACCT...
Protein
Download Protein FASTA254 aa · LXL04_039337|LXL04_039337|OH1004|PROTEIN
MLLIHILSSITNSPLTLCFHHCKQNKLGRGHRDKVQQFMTITGASEKVALQALKASDWHLDGAFDVFYNPYADMIMADGISNLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFVGGLQSLGIDSLEKFRERIPFMRSELKDDQKFKEIYIFAFGWAKEKGQKSLALDTAIGMWQLLFEEKEWPLVDHWCQFLQARHNKAISRDTWSQLLEFARSVDPTLANYDAAGAWPYLIDEFVEYLIENGITEKGSVK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_039337 |
|---|---|
| TK1151 ID | TkA04G231320 |
| OH-1004 ID | LXL04_039337 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 90.900 |
| Protein coverage (%) | TK1151 99.605 / OH-1004 90.551Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_039337 |
|---|---|
| Location | JAJTUU010000010.1:3450296-3453263 (-) |
| Description | Similar to DCUN1D1: DCN1-like protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0031396 regulation of protein ubiquitination Biological Process GO:0045116 protein neddylation Biological Process GO:2000434 regulation of protein neddylation Biological Process GO:2000436 positive regulation of protein neddylation Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0031624 ubiquitin conjugating enzyme binding Molecular Function GO:0032182 ubiquitin-like protein binding Molecular Function GO:0097602 cullin family protein binding Molecular Function |
| KEGG gene cross-reference | gga:424963 hsa:54165 hsa:55208 mmu:102323 mmu:114893 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22566.3UBA_832-69 aaPF14555.13UBA_433-69 aaPF03556.22Cullin_binding131-241 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_039337 | PF22566.3 | UBA_8 | 32 | 69 | 9.8e-11 | 42.0 |
| LXL04_039337 | PF14555.13 | UBA_4 | 33 | 69 | 1.2e-12 | 48.1 |
| LXL04_039337 | PF03556.22 | Cullin_binding | 131 | 241 | 2.9e-37 | 128.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.