LXL04_039330 | RubberDandelionOmics

Gene overview

LXL04_039330

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 3207708-3210790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · LXL04_039330|LXL04_039330|OH1004|cDNA

ATGGCATCCGCCTTTCTTTCAAGAACTCTCTTTGCACATCGTTTCGTCTCTTCCTTCGCCCTCACTCAAAAACCCCAAAAATTAGCGCCCCTGTTCTTCAGGAAACCTCTTCACTCGTGGGCTTCCCCATCGCATACGGTGTACCGGAGACTAAACATAGTTCGTAGTGACATGGCTTCTACCGTAATCGGATCTACATCTTCTTTTTCAACACAATCCATGTCAACTAGCGAGCCTGTCGTTTCAGTCGACTGGCTTCA...

CDS

Download CDS FASTA

1137 bp · LXL04_039330|LXL04_039330|OH1004|CDS

ATGGCATCCGCCTTTCTTTCAAGAACTCTCTTTGCACATCGTTTCGTCTCTTCCTTCGCCCTCACTCAAAAACCCCAAAAATTAGCGCCCCTGTTCTTCAGGAAACCTCTTCACTCGTGGGCTTCCCCATCGCATACGGTGTACCGGAGACTAAACATAGTTCGTAGTGACATGGCTTCTACCGTAATCGGATCTACATCTTCTTTTTCAACACAATCCATGTCAACTAGCGAGCCTGTCGTTTCAGTCGACTGGCTTCA...

Protein

Download Protein FASTA

378 aa · LXL04_039330|LXL04_039330|OH1004|PROTEIN

MASAFLSRTLFAHRFVSSFALTQKPQKLAPLFFRKPLHSWASPSHTVYRRLNIVRSDMASTVIGSTSSFSTQSMSTSEPVVSVDWLHANLREPDMKVLDASWYMPDEQRNPLQEYQVAHIPGALFFDVDGISDRTTNLPHMLPSEEAFAAAVSALGIENKDGVVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGFDVESSASSDAILKASAASEAIEKVYHGQAVGPVTFQTRFQSHLVWTLEQVKKNIED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039330`
TK1151 ID	TkA04G234240
OH-1004 ID	LXL04_039330
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039330

Location JAJTUU010000010.1:3207708-3210790 (+)

Description Similar to STR1: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79230`	Catalyzes the transfer of a sulfur ion from a donor to cyanide or to other thiol compounds.	Plant mercaptopyruvate sulfurtransferases: molecular cloning, subcellular localization and enzymatic activities.2000 · DOI: 10.1046/j.1432-1327.2000.01633.x Sulfurtransferases 1 and 2 play essential roles in embryo and seed development in Arabidopsis thaliana.2011 · DOI: 10.1074/jbc.m110.182865
`At1g16460`	Catalyzes the transfer of a sulfur ion from a donor to cyanide or to other thiol compounds.	Sulfurtransferases 1 and 2 play essential roles in embryo and seed development in Arabidopsis thaliana.2011 · DOI: 10.1074/jbc.m110.182865

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039330 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000098 sulfur amino acid catabolic process Biological Process

GO:0002143 tRNA wobble position uridine thiolation Biological Process

GO:0009440 cyanate catabolic process Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0019346 transsulfuration Biological Process

GO:0070814 hydrogen sulfide biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G16460

ath:AT1G79230

hsa:4357

mmu:246221

rno:192172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.795

Rank 1 · LXL04_039330 · OH-1004

Cytoplasm0.157

Rank 2 · LXL04_039330 · OH-1004

Plastid0.105

Rank 3 · LXL04_039330 · OH-1004

Nucleus0.073

Rank 4 · LXL04_039330 · OH-1004

Peroxisome0.024

Rank 5 · LXL04_039330 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00581.26Rhodanese82-201 aa

PF00581.26Rhodanese250-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039330	`PF00581.26`	Rhodanese	82	201	7.4e-29	100.9
LXL04_039330	`PF00581.26`	Rhodanese	250	366	7.4e-29	100.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64530`	Arabidopsis thaliana	Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial	71.204%	Swiss-Prot	strong database homology
`Q24JL3`	Arabidopsis thaliana	Thiosulfate/3-mercaptopyruvate sulfurtransferase 2	72.812%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card