LXL04_039322 | RubberDandelionOmics

Gene overview

LXL04_039322

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 2745134-2745532 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · LXL04_039322|LXL04_039322|OH1004|cDNA

ATGAAAAAGTTAATCCGCCGCCTCTCTCGCGTCGCCGACTCATCTCCCTACTCTCTCCTCCGCTCAGAATCTCgctcctccaccaccaccgtcCGCCTGACCCAATCCTTCCGTATCACCAAGCCTCGACGCTCCGGCACCGTACCAGAAGGACACCTCCCGGTCTTCGTCGGAGAAGAGATGGAACGATTCGTGGTGAGCGCCGAGCTACTAAACCACCCGATCTTCATTAATTTACTTAATAAGTCCGCTCAAGAGTA...

CDS

Download CDS FASTA

399 bp · LXL04_039322|LXL04_039322|OH1004|CDS

ATGAAAAAGTTAATCCGCCGCCTCTCTCGCGTCGCCGACTCATCTCCCTACTCTCTCCTCCGCTCAGAATCTCGCTCCTCCACCACCACCGTCCGCCTGACCCAATCCTTCCGTATCACCAAGCCTCGACGCTCCGGCACCGTACCAGAAGGACACCTCCCGGTCTTCGTCGGAGAAGAGATGGAACGATTCGTGGTGAGCGCCGAGCTACTAAACCACCCGATCTTCATTAATTTACTTAATAAGTCCGCTCAAGAGTA...

Protein

Download Protein FASTA

132 aa · LXL04_039322|LXL04_039322|OH1004|PROTEIN

MKKLIRRLSRVADSSPYSLLRSESRSSTTTVRLTQSFRITKPRRSGTVPEGHLPVFVGEEMERFVVSAELLNHPIFINLLNKSAQEYGYEQKGVLHIPCHVIVFERVLEALRAGRAASASQNIQDLLSGEFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039322`
TK1151 ID	TkA04G235630
OH-1004 ID	LXL04_039322
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	91.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039322

Location JAJTUU010000010.1:2745134-2745532 (+)

Description Similar to SAUR72: Auxin-responsive protein SAUR72

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12830`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	No verified direct reference in this release
`At1g56150`	Plays a role in the regulation of cell expansion, root meristem patterning and auxin transport.	No verified direct reference in this release
`At1g16510`	Plays a role in the regulation of cell expansion, root meristem patterning and auxin transport.	Tissue-specific expression of SMALL AUXIN UP RNA41 differentially regulates cell expansion and root meristem patterning in Arabidopsis.2013 · DOI: 10.1093/pcp/pct028
`At1g79130`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	No verified direct reference in this release
`At2g46690`	May play a role in the apical hook development (Ref.7).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0060918 auxin transport Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:1900140 regulation of seedling development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G16510

ath:AT1G56150

ath:AT1G79130

ath:AT2G46690

ath:AT3G12830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · LXL04_039322 · OH-1004

Nucleus0.372

Rank 2 · LXL04_039322 · OH-1004

Cell membrane0.256

Rank 3 · LXL04_039322 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_039322 · OH-1004

Plastid0.029

Rank 5 · LXL04_039322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519.21Auxin_inducible2-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039322	`PF02519.21`	Auxin_inducible	2	114	6.6e-28	97.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTV3`	Arabidopsis thaliana	Auxin-responsive protein SAUR72	64.394%	Swiss-Prot	strong database homology
`Q9SGU2`	Arabidopsis thaliana	Auxin-responsive protein SAUR71	66.379%	Swiss-Prot	strong database homology
`Q9SA49`	Arabidopsis thaliana	Auxin-responsive protein SAUR41	61.702%	Swiss-Prot	strong database homology
`O64538`	Arabidopsis thaliana	Auxin-responsive protein SAUR40	57.692%	Swiss-Prot	strong database homology
`Q9ZUZ3`	Arabidopsis thaliana	Auxin-responsive protein SAUR32	37.374%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card