Gene Card
Gene overview
cDNA / CDS / Protein Sequences
7239 bp · LXL04_039189|LXL04_039189|OH1004|cDNA
ATAATGAGATCTAGCAAGACTTAATTTCTACAGGACATTCGAACAACTTGGATATGGGGTTTGGATTAATTATATTTGTGATAAATTGGCATTATCAATGTCTTTGCTCCAATTACGGAAATGTAATGACAAGTGTTTTAATTTCAGAATTACTTTATCTCTTACTATTGCAGAGAAATGGGTGTGAGTGTAAAAAACATGGATATATCTTTGGGAGAAATTAGTGTAGACCTAAACGAGGATCTAATGTCCAAAAAGAA...
7062 bp · LXL04_039189|LXL04_039189|OH1004|CDS
ATGGGTGTGAGTGTAAAAAACATGGATATATCTTTGGGAGAAATTAGTGTAGACCTAAACGAGGATCTAATGTCCAAAAAGAACAAGTCATCAGTCACTCATTATGCTGATGAACCTATAAAACCTCCTGCCAATGAAGCTGACATTGCCAAGAAGCAACAAAAGAAACAAGCAGCACTTGCGGCCATCACAAAGCTGACACCATTTTTCCCGGAAAAGGTTTCCATCATTTTGCCAAAGCTGGATGTGAAGTTTGTACA...
Protein
Download Protein FASTA2353 aa · LXL04_039189|LXL04_039189|OH1004|PROTEIN
MGVSVKNMDISLGEISVDLNEDLMSKKNKSSVTHYADEPIKPPANEADIAKKQQKKQAALAAITKLTPFFPEKVSIILPKLDVKFVHKEYHVVMENNITAVQFKSIKSVSIEDVGERTCLDLQLEISEIHILKEGGSSVLKLLKLSVLSFVYIPSQPTSPIKIETDVKLGGTQCNIIMTRLKALMQLRAPKKRKTVLPKDQSANPVVVQSVDDFKLIIWTCTFSAPETTIALINLEELPVYHGCLQSSRIFANNTSSTGT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_039189 |
|---|---|
| TK1151 ID | TkA04G514160 |
| OH-1004 ID | LXL04_039189 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.400 |
| Protein coverage (%) | TK1151 90.983 / OH-1004 99.958Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_039189 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr09:61893200-61909378 (+) | |||||||||
| Description | Similar to SAB: Protein SABRE | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009723 response to ethylene Biological Process GO:0009860 pollen tube growth Biological Process GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0030307 positive regulation of cell growth Biological Process GO:0048768 root hair cell tip growth Biological Process GO:0048868 pollen tube development Biological Process GO:0051510 regulation of unidimensional cell growth Biological Process GO:1903307 positive regulation of regulated secretory pathway Biological Process GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G58250 ath:AT5G49680 dme:Dmel_CG14967 hsa:9703 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10344.16Hobbit2-2267 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_039189 | PF10344.16 | Hobbit | 2 | 2267 | 1830.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.