LXL04_039187 | RubberDandelionOmics

Gene overview

LXL04_039187

Reference: OH-1004 Chr: Chr09 Coordinates: 61874409-61876869 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1338 bp · LXL04_039187|LXL04_039187|OH1004|cDNA

ATGAAGCTTGATGTGGATGTTTTACGGTACCTTTCCAAAGATGACTTCAGGGTTCTTACTGCTGTTGAGATGGGAATGCGTAATCACGAAATTGTACCTGCGGAGCTCATTGACCGCATTGCTTCACTAAGACATGGTGGAACTTATAAAGTATTGAAGAATCTACTGAAACACAAGTTGCTGCATCATGATTCATCAAAGTATGATGGATTCCGGCTAACATACCTTGGATACGATTTTCTTGCGATAAAGACTCTGGT...

CDS

Download CDS FASTA

1338 bp · LXL04_039187|LXL04_039187|OH1004|CDS

ATGAAGCTTGATGTGGATGTTTTACGGTACCTTTCCAAAGATGACTTCAGGGTTCTTACTGCTGTTGAGATGGGAATGCGTAATCACGAAATTGTACCTGCGGAGCTCATTGACCGCATTGCTTCACTAAGACATGGTGGAACTTATAAAGTATTGAAGAATCTACTGAAACACAAGTTGCTGCATCATGATTCATCAAAGTATGATGGATTCCGGCTAACATACCTTGGATACGATTTTCTTGCGATAAAGACTCTGGT...

Protein

Download Protein FASTA

445 aa · LXL04_039187|LXL04_039187|OH1004|PROTEIN

MKLDVDVLRYLSKDDFRVLTAVEMGMRNHEIVPAELIDRIASLRHGGTYKVLKNLLKHKLLHHDSSKYDGFRLTYLGYDFLAIKTLVNRGVFSSVGRQIGVGKESDIFEVANEDGTVMAMKLHRLGRTSFRAVKTKRDYLKHRSSFSWLYLSRLAALKEFAFMKALQEHGFPVPNAVDCNRHCVIMSLVQGYPLVQVKQLQNTDTVFDKILGIIVRLAEHGLIHCDFNEFNIMIDDDEKITIIDFPQMVSVSHRNAEMYF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039187`
TK1151 ID	TkA04G514150
OH-1004 ID	LXL04_039187
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_039187`
Location	Chr09:61874409-61876869 (+)
Description	Similar to rio2: Serine/threonine-protein kinase rio2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039187` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006468 protein phosphorylation Biological Process GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0046777 protein autophosphorylation Biological Process GO:2000208 positive regulation of ribosomal small subunit export from nucleus Biological Process GO:2000234 positive regulation of rRNA processing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0030688 preribosome, small subunit precursor Cellular Component
KEGG gene cross-reference	cel:CELE_Y105E8B.3 ddi:DDB_G0282099 hsa:55781 mmu:67045 spo:2539957 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.631

Rank 1 · LXL04_039187 · OH-1004

Nucleus0.350

Rank 2 · LXL04_039187 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_039187 · OH-1004

Mitochondrion0.063

Rank 4 · LXL04_039187 · OH-1004

Endoplasmic reticulum0.059

Rank 5 · LXL04_039187 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09202.18Rio2_N8-89 aa

PF01163.29RIO1106-279 aa

PF03109.23ABC1170-260 aa

PF01636.30APH218-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039187	`PF09202.18`	Rio2_N	8	89	6.3e-35	120.1
LXL04_039187	`PF01163.29`	RIO1	106	279	2e-56	191.3
LXL04_039187	`PF03109.23`	ABC1	170	260	5.9e-08	32.9
LXL04_039187	`PF01636.30`	APH	218	245	7.8e-07	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card