LXL04_039183 | RubberDandelionOmics

Gene overview

LXL04_039183

Reference: OH-1004 Chr: Chr09 Coordinates: 61808707-61810998 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · LXL04_039183|LXL04_039183|OH1004|cDNA

GAATCTATAAAACAACAAAAGTAGGTGGAATCTTCTTCAATCTCAAAACTAATGGCTTTTGCAAGTTCGATTCTCTTCAACCTTAATTTCTCTTTGAAGCTCAACAATGGATCAAAACTTCACCTCCCAAAATATTCTCTCCGAAAGCCTAGAAATTCCTCATCCTTATCATCTACACATCTTTTTTCTCCATTGCGTTCATGTTCCGTCAGTGAAAATGCAGATGGATCCAGTATCAGTTACAGGAAGATCGTTCCAAC...

CDS

Download CDS FASTA

1314 bp · LXL04_039183|LXL04_039183|OH1004|CDS

ATGGCTTTTGCAAGTTCGATTCTCTTCAACCTTAATTTCTCTTTGAAGCTCAACAATGGATCAAAACTTCACCTCCCAAAATATTCTCTCCGAAAGCCTAGAAATTCCTCATCCTTATCATCTACACATCTTTTTTCTCCATTGCGTTCATGTTCCGTCAGTGAAAATGCAGATGGATCCAGTATCAGTTACAGGAAGATCGTTCCAACTCGATACCAATCAAAATCTAAATTTATCGTTCGATCTTCGGCCAAGAGTTC...

Protein

Download Protein FASTA

437 aa · LXL04_039183|LXL04_039183|OH1004|PROTEIN

MAFASSILFNLNFSLKLNNGSKLHLPKYSLRKPRNSSSLSSTHLFSPLRSCSVSENADGSSISYRKIVPTRYQSKSKFIVRSSAKSSQSQAPSVSKGTIIFWSAVTLVLAVGNRVLYKLALVPMKEYPFFLAQVNTFGYVAIYFSILYLRHRAGIVTDEMMVLPKWRFAVIGMLEALGVVIGMYSAAMLPGPAIPILNQTFLLWQLGFSALLLGRRYSWNKIGGCLLVAAGVVTAIASGSESGQMLAGVGMMWPIMMVVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039183`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039183

Location Chr09:61808707-61810998 (+)

Description Similar to CLT2: Protein CLT2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24460`	Involved in thiol transport from the plastid to the cytosol.	No verified direct reference in this release
`At5g12170`	Involved in thiol transport from the plastid to the cytosol.	No verified direct reference in this release
`At5g19380`	Involved in thiol transport from the plastid to the cytosol.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006865 amino acid transport Biological Process

GO:0034635 glutathione transport Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0012506 vesicle membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G24460

ath:AT5G12170

ath:AT5G19380

ddi:DDB_G0276943

ddi:DDB_G0277321

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.949

Rank 1 · LXL04_039183 · OH-1004

Golgi apparatus0.062

Rank 2 · LXL04_039183 · OH-1004

Endoplasmic reticulum0.036

Rank 3 · LXL04_039183 · OH-1004

Peroxisome0.033

Rank 4 · LXL04_039183 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_039183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08627.17CRT-like100-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039183	`PF08627.17`	CRT-like	100	422	5.2e-36	125.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A1L4X0`	Arabidopsis thaliana	Protein CLT2, chloroplastic	66.097%	Swiss-Prot	strong database homology
`Q8RWL5`	Arabidopsis thaliana	Protein CLT3, chloroplastic	50.681%	Swiss-Prot	strong database homology
`Q058P6`	Arabidopsis thaliana	Protein CLT1, chloroplastic	53.870%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card