LXL04_038994 | RubberDandelionOmics

Gene overview

LXL04_038994

Reference: OH-1004 Chr: Chr09 Coordinates: 55776771-55780403 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1266 bp · LXL04_038994|LXL04_038994|OH1004|cDNA

ATGAGAAATCAATTTTGTGAATGGGTTTTCATTTTCGTGATTGGATTTGTTGTTTTTGGGAAATCGGCGAGTGGATATGAGTTCGATGAAACGGAGTACCATTTTAATACAACAGAAGTTCTTTCATTATTAGAAGCCTCTTCAGCTGCTGCCGCTCCTAAACCGCTGCTTGTCGGCCTCACTCTTATCGCCGGAGCTGCTGCTAAAGGCGCCGTATGTTTGGATGGAACTTTACCTGGGTACCATTTGCACCGTGGATT...

CDS

Download CDS FASTA

1266 bp · LXL04_038994|LXL04_038994|OH1004|CDS

ATGAGAAATCAATTTTGTGAATGGGTTTTCATTTTCGTGATTGGATTTGTTGTTTTTGGGAAATCGGCGAGTGGATATGAGTTCGATGAAACGGAGTACCATTTTAATACAACAGAAGTTCTTTCATTATTAGAAGCCTCTTCAGCTGCTGCCGCTCCTAAACCGCTGCTTGTCGGCCTCACTCTTATCGCCGGAGCTGCTGCTAAAGGCGCCGTATGTTTGGATGGAACTTTACCTGGGTACCATTTGCACCGTGGATT...

Protein

Download Protein FASTA

421 aa · LXL04_038994|LXL04_038994|OH1004|PROTEIN

MRNQFCEWVFIFVIGFVVFGKSASGYEFDETEYHFNTTEVLSLLEASSAAAAPKPLLVGLTLIAGAAAKGAVCLDGTLPGYHLHRGFESGANSWLIQLEGGGWCNTIRSCVYRKTTRRGSSNFFEKQLAFTGILSDKAEENPDFFNWNRVKVRYCDGASFAGDSEDKANNLQFRGQKIWMAAMEDLMAKGMSNADHALLSGCSAGGLASILHCDEFHSLFNGRAKVKCLADAGMFMDAIDVSGGRTLRNMYEGVVTLQGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038994`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038994

Location Chr09:55776771-55780403 (-)

Description Similar to PAE10: Pectin acetylesterase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26670`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At3g05910`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At2g46930`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At1g57590`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At3g62060`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038994 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009625 response to insect Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0052793 pectin acetylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G57590

ath:AT2G46930

ath:AT3G05910

ath:AT3G62060

ath:AT5G26670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.446

Rank 1 · LXL04_038994 · OH-1004

Extracellular0.241

Rank 2 · LXL04_038994 · OH-1004

Golgi apparatus0.134

Rank 3 · LXL04_038994 · OH-1004

Cytoplasm0.114

Rank 4 · LXL04_038994 · OH-1004

Cell membrane0.100

Rank 5 · LXL04_038994 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03283.20PAE54-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038994	`PF03283.20`	PAE	54	416	3.2e-168	560.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GM8`	Arabidopsis thaliana	Pectin acetylesterase 10	67.548%	Swiss-Prot	strong database homology
`Q9SFF6`	Arabidopsis thaliana	Pectin acetylesterase 12	66.425%	Swiss-Prot	strong database homology
`O80731`	Arabidopsis thaliana	Pectin acetylesterase 3	64.373%	Swiss-Prot	strong database homology
`F4I839`	Arabidopsis thaliana	Pectin acetylesterase 2	62.264%	Swiss-Prot	strong database homology
`Q84JS1`	Arabidopsis thaliana	Pectin acetylesterase 6	66.150%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card