LXL04_038975 | RubberDandelionOmics

Gene overview

LXL04_038975

Reference: OH-1004 Chr: Chr09 Coordinates: 55275141-55279515 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2020 bp · LXL04_038975|LXL04_038975|OH1004|cDNA

ATGCGAATTCACTCGCTACGAACTGTCTTCTGTTTTCAGGACGGAAGCAATCCAGATGAATCAATAAGCCCTAATAGCATTGCAATCAATACTTGTAAAGATGCACGAAATGTTCGGATCAGTTCGTCGATCTCTGGTTTTTCGTACTCCCGACGTCGGTGATCCAGGAACCCTAGCCGACAAAATCCATTCATGTATTCGCAAGTCTAGAGTTTTTTCCAGAACTTCCTCACTTCTACCTTCACCGCCACGGACTGTAA...

CDS

Download CDS FASTA

1941 bp · LXL04_038975|LXL04_038975|OH1004|CDS

TTGCAATCAATACTTGTAAAGATGCACGAAATGTTCGGATCAGTTCGTCGATCTCTGGTTTTTCGTACTCCCGACGTCGGTGATCCAGGAACCCTAGCCGACAAAATCCATTCATGTATTCGCAAGTCTAGAGTTTTTTCCAGAACTTCCTCACTTCTACCTTCACCGCCACGGACTGTAAAAGAGAATGATGAGCTAGTTCCTACTATCCGTTGGCGTAAGGGCGAATTGATTGGATGCGGGGCTTTTGGTCAAGTGTA...

Protein

Download Protein FASTA

646 aa · LXL04_038975|LXL04_038975|OH1004|PROTEIN

MQSILVKMHEMFGSVRRSLVFRTPDVGDPGTLADKIHSCIRKSRVFSRTSSLLPSPPRTVKENDELVPTIRWRKGELIGCGAFGQVYMGMNLDSGELLAVKQVSIAAHSASKEKTQAHIRELEEEVKLLKNLSHSNIVRYLGTVREEETLNILLEFVPGGSISSLLGKFGPFPEAVIRMYTKQLLLGLDYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKQVVELANGSGAKSMKGTPYWMAPEVILQTGHSFSADI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038975`
TK1151 ID	TkA04G489090
OH-1004 ID	LXL04_038975
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 89.291 / OH-1004 98.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038975

Location Chr09:55275141-55279515 (-)

Description Similar to ANP1: Mitogen-activated protein kinase kinase kinase ANP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09000`	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.	Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940 An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164
`At1g54960`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At3g06030`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038975 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0030435 sporulation resulting in formation of a cellular spore Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G09000

ath:AT1G54960

ath:AT3G06030

ddi:DDB_G0283265

nta:107796336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.653

Rank 1 · LXL04_038975 · OH-1004

Nucleus0.300

Rank 2 · LXL04_038975 · OH-1004

Cell membrane0.188

Rank 3 · LXL04_038975 · OH-1004

Golgi apparatus0.069

Rank 4 · LXL04_038975 · OH-1004

Mitochondrion0.054

Rank 5 · LXL04_038975 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase73-335 aa

PF07714.24PK_Tyr_Ser-Thr75-331 aa

PF17667.8Pkinase_fungal189-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038975	`PF00069.32`	Pkinase	73	335	1.8e-73	247.9
LXL04_038975	`PF07714.24`	PK_Tyr_Ser-Thr	75	331	6.1e-49	167.4
LXL04_038975	`PF17667.8`	Pkinase_fungal	189	262	1.8e-06	27.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22040`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase ANP1	55.908%	Swiss-Prot	strong database homology
`Q9FZ36`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 2	55.202%	Swiss-Prot	strong database homology
`O22042`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 3	53.835%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card