LXL04_038969 | RubberDandelionOmics

Gene overview

LXL04_038969

Reference: OH-1004 Chr: Chr09 Coordinates: 55222980-55226561 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2360 bp · LXL04_038969|LXL04_038969|OH1004|cDNA

ttgtctttcaaataatTTGTTGCTTCCAAGCAATACATAAGTTATTGCCTTATCTTCCATCTCTTTCTTCCTCGTCAATCTCTCCGCCAATGAAGTCAGCAGCAGCGATAATGTCAGGCCTTTCTCTCTCTACATCGCCGCCGCGCTCCGCCTACCTTTCGTCATATTCATCCCACCGTTGCTTCAGTTTATTTTCTCTATCACTCCCGATTTTCCGTTCTCTTAACTCCATGAAGAGGCCCCCAATTCATGTAAATCAC...

CDS

Download CDS FASTA

2316 bp · LXL04_038969|LXL04_038969|OH1004|CDS

TTGCCTTATCTTCCATCTCTTTCTTCCTCGTCAATCTCTCCGCCAATGAAGTCAGCAGCAGCGATAATGTCAGGCCTTTCTCTCTCTACATCGCCGCCGCGCTCCGCCTACCTTTCGTCATATTCATCCCACCGTTGCTTCAGTTTATTTTCTCTATCACTCCCGATTTTCCGTTCTCTTAACTCCATGAAGAGGCCCCCAATTCATGTAAATCACAGTAACCCGGTGTTCGTCGTTCGTAATGCCTCATCAACCTCTTC...

Protein

Download Protein FASTA

771 aa · LXL04_038969|LXL04_038969|OH1004|PROTEIN

MPYLPSLSSSSISPPMKSAAAIMSGLSLSTSPPRSAYLSSYSSHRCFSLFSLSLPIFRSLNSMKRPPIHVNHSNPVFVVRNASSTSSGSSSITAKPSSEMRKNHNGSSKGRDQDQKLTALRELFGKPGINIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKHKAALWTDGRYFLQVYPIVSVLSHFKAIIIIFAEHLCLILSFFDLIHQAEKQLSSSWILMRAGNWGVPNTTEWLNDVLASGARIGIDPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038969`
TK1151 ID	TkA04G488950
OH-1004 ID	LXL04_038969
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 55.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038969

Location Chr09:55222980-55226561 (+)

Description Similar to APP2: Aminopeptidase P2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05350`	Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038969 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0070006 metalloaminopeptidase activity Molecular Function

KEGG gene cross-reference

ani:ANIA_11005

ath:AT3G05350

ncr:NCU00112

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.684

Rank 1 · LXL04_038969 · OH-1004

Cytoplasm0.281

Rank 2 · LXL04_038969 · OH-1004

Nucleus0.119

Rank 3 · LXL04_038969 · OH-1004

Peroxisome0.116

Rank 4 · LXL04_038969 · OH-1004

Mitochondrion0.075

Rank 5 · LXL04_038969 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01321.25Creatinase_N119-277 aa

PF16189.12Creatinase_N_2298-478 aa

PF00557.30Peptidase_M24480-697 aa

PF16188.11Peptidase_M24_C709-768 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038969	`PF01321.25`	Creatinase_N	119	277	6.4e-13	50.1
LXL04_038969	`PF16189.12`	Creatinase_N_2	298	478	1.5e-48	165.6
LXL04_038969	`PF00557.30`	Peptidase_M24	480	697	6.9e-50	170.4
LXL04_038969	`PF16188.11`	Peptidase_M24_C	709	768	3.6e-24	85.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY11`	Arabidopsis thaliana	Aminopeptidase P2	66.180%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card