LXL04_038880 | RubberDandelionOmics

Gene overview

LXL04_038880

Reference: OH-1004 Chr: Chr09 Coordinates: 52395285-52395821 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · LXL04_038880|LXL04_038880|OH1004|cDNA

ATGTCGGGAAGCAGAACCCCAAACCCTAACGTGGAAGACATGGCTAGGAGAAACGCCACCTTAATTGCCCAAGAAGTTGAAGAAAACCCTAACTCTATTAACCAATTACACCGTCGCAAGTACAAGTGCAGCGACTGTAAGAATGAGTACGATAGCTTTCAAGCCCTAGGCGGCCACCGGGCCAGCCACCGGAGAAGTGTTAATGCGACGAATCTTGGAACGAATTGTGAAGTTAAGATACATAAATGCAGGGTTTGTGG...

CDS

Download CDS FASTA

537 bp · LXL04_038880|LXL04_038880|OH1004|CDS

ATGTCGGGAAGCAGAACCCCAAACCCTAACGTGGAAGACATGGCTAGGAGAAACGCCACCTTAATTGCCCAAGAAGTTGAAGAAAACCCTAACTCTATTAACCAATTACACCGTCGCAAGTACAAGTGCAGCGACTGTAAGAATGAGTACGATAGCTTTCAAGCCCTAGGCGGCCACCGGGCCAGCCACCGGAGAAGTGTTAATGCGACGAATCTTGGAACGAATTGTGAAGTTAAGATACATAAATGCAGGGTTTGTGG...

Protein

Download Protein FASTA

178 aa · LXL04_038880|LXL04_038880|OH1004|PROTEIN

MSGSRTPNPNVEDMARRNATLIAQEVEENPNSINQLHRRKYKCSDCKNEYDSFQALGGHRASHRRSVNATNLGTNCEVKIHKCRVCGEGFETGQALGGHMRKHWLPKGDKEKKGLRHGKKTTRETAMVVPYDHGSPSSVITSNSNGKEAFGYDLNLTPHENELKFGVQSDNRTSSEAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038880`
TK1151 ID	TkA04G473400
OH-1004 ID	LXL04_038880
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038880

Location Chr09:52395285-52395821 (+)

Description Similar to ZAT18: Zinc finger protein ZAT18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53600`	Transcription factor involved in stress responses (Probable).	The Arabidopsis Cys2/His2 zinc finger transcription factor ZAT18 is a positive regulator of plant tolerance to drought stress.2017 · DOI: 10.1093/jxb/erx157
`At2g37430`	Probable transcription factor that may be involved in stress responses.	No verified direct reference in this release
`At3g46080`	Probable transcription factor that may be involved in stress responses.	No verified direct reference in this release
`At3g46090`	Probable transcription factor involved in oxidative stress response.	The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.2004 · DOI: 10.1074/jbc.m313350200
`At5g59820`	Transcriptional repressor involved in light acclimation, cold and oxidative stress responses.	A zinc finger protein RHL41 mediates the light acclimatization response in Arabidopsis.2000 · DOI: 10.1046/j.1365-313x.2000.00864.x The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.2004 · DOI: 10.1074/jbc.m313350200 Roles of the CBF2 and ZAT12 transcription factors in configuring the low temperature transcriptome of Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2004.02288.x The zinc-finger protein Zat12 plays a central role in reactive oxygen and abiotic stress signaling in Arabidopsis.2005 · DOI: 10.1104/pp.105.068254

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038880 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006950 response to stress Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009631 cold acclimation Biological Process

KEGG gene cross-reference

ath:AT2G37430

ath:AT3G46080

ath:AT3G46090

ath:AT3G53600

ath:AT5G59820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_038880 · OH-1004

Cytoplasm0.081

Rank 2 · LXL04_038880 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_038880 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_038880 · OH-1004

Plastid0.008

Rank 5 · LXL04_038880 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912.13zf-C2H2_641-65 aa

PF13912.13zf-C2H2_681-104 aa

PF13894.13zf-C2H2_481-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038880	`PF13912.13`	zf-C2H2_6	41	65	2.2e-20	72.8
LXL04_038880	`PF13912.13`	zf-C2H2_6	81	104	2.2e-20	72.8
LXL04_038880	`PF13894.13`	zf-C2H2_4	81	103	2e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFG0`	Arabidopsis thaliana	Zinc finger protein ZAT18	34.177%	Swiss-Prot	moderate database homology
`Q9SLD4`	Arabidopsis thaliana	Zinc finger protein ZAT11	35.338%	Swiss-Prot	moderate database homology
`Q9LX85`	Arabidopsis thaliana	Zinc finger protein ZAT8	33.333%	Swiss-Prot	moderate database homology
`Q42453`	Arabidopsis thaliana	Zinc finger protein ZAT7	50.704%	Swiss-Prot	weak database homology
`Q42410`	Arabidopsis thaliana	Zinc finger protein ZAT12	34.615%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card