LXL04_038686 | RubberDandelionOmics

Gene overview

LXL04_038686

Reference: OH-1004 Chr: Chr09 Coordinates: 48106044-48111132 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_038686|LXL04_038686|OH1004|cDNA

ATGGGCCATGGAAGTTCGAAATCAAGTTCGTTGGATGAGTCTTCAGACTCATCCGGTGGTACAAATTCAAAACCACCTCCGTCGTTTCGCGAAAGAATCAAAAAGAAATTACATCTCCACCGTCGGCCGGCCGCTTCACAGCATGCTAAACTCAACCGTGACGAGGATTTCGCCGGCATCGCTTTGGTCACTCTAATTAGTGCGGAAATGAAATTCAAGGACAAGTGGCTTGCTTGCATTTCAATTGGAGAACAGACGTT...

CDS

Download CDS FASTA

1950 bp · LXL04_038686|LXL04_038686|OH1004|CDS

ATGGGCCATGGAAGTTCGAAATCAAGTTCGTTGGATGAGTCTTCAGACTCATCCGGTGGTACAAATTCAAAACCACCTCCGTCGTTTCGCGAAAGAATCAAAAAGAAATTACATCTCCACCGTCGGCCGGCCGCTTCACAGCATGCTAAACTCAACCGTGACGAGGATTTCGCCGGCATCGCTTTGGTCACTCTAATTAGTGCGGAAATGAAATTCAAGGACAAGTGGCTTGCTTGCATTTCAATTGGAGAACAGACGTT...

Protein

Download Protein FASTA

649 aa · LXL04_038686|LXL04_038686|OH1004|PROTEIN

MGHGSSKSSSLDESSDSSGGTNSKPPPSFRERIKKKLHLHRRPAASQHAKLNRDEDFAGIALVTLISAEMKFKDKWLACISIGEQTFRTDTSDQTNMPTWNSEKKFVLESNGPHMAKISVFETNRLSKNNLIGYCEIDLFEFLSRVSDSDIEVFDLFDPSSSNVVVGKISISCSVEDPIETEKSFARRILSIVDYNGDGKLSFSEFSELINAFGNQLAAKKKEELFKSADVNGDGVVSMDELATLLAMQQEKEPLMNCCP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038686`
TK1151 ID	TkA04G455550
OH-1004 ID	LXL04_038686
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038686

Location Chr09:48106044-48111132 (-)

Description Similar to PSD2: Phosphatidylserine decarboxylase proenzyme 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57190`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	Deficiency in phosphatidylserine decarboxylase activity in the psd1 psd2 psd3 triple mutant of Arabidopsis affects phosphatidylethanolamine accumulation in mitochondria.2007 · DOI: 10.1104/pp.107.095414
`At4g25970`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	Deficiency in phosphatidylserine decarboxylase activity in the psd1 psd2 psd3 triple mutant of Arabidopsis affects phosphatidylethanolamine accumulation in mitochondria.2007 · DOI: 10.1104/pp.107.095414

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0959800`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038686 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0016540 protein autoprocessing Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT4G25970

ath:AT5G57190

dosa:Os01g0959800

ppa:PAS_chr3_1127

spo:2543178

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.262

Rank 1 · LXL04_038686 · OH-1004

Cytoplasm0.256

Rank 2 · LXL04_038686 · OH-1004

Cell membrane0.187

Rank 3 · LXL04_038686 · OH-1004

Golgi apparatus0.183

Rank 4 · LXL04_038686 · OH-1004

Mitochondrion0.153

Rank 5 · LXL04_038686 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C280-143 aa

PF13499.13EF-hand_7186-245 aa

PF00036.39EF-hand_1187-212 aa

PF00036.39EF-hand_1223-248 aa

PF13202.13EF-hand_5224-245 aa

PF02666.21PS_Dcarbxylase421-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038686	`PF00168.37`	C2	80	143	1.3e-08	35.7
LXL04_038686	`PF13499.13`	EF-hand_7	186	245	8.6e-10	39.5
LXL04_038686	`PF00036.39`	EF-hand_1	187	212	1.4e-11	43.8
LXL04_038686	`PF00036.39`	EF-hand_1	223	248	1.4e-11	43.8
LXL04_038686	`PF13202.13`	EF-hand_5	224	245	2.5e-11	43.2
LXL04_038686	`PF02666.21`	PS_Dcarbxylase	421	615	1.8e-58	198.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAK5`	Arabidopsis thaliana	Phosphatidylserine decarboxylase proenzyme 2	71.520%	Swiss-Prot	strong database homology
`A4GNA8`	Arabidopsis thaliana	Phosphatidylserine decarboxylase proenzyme 3	72.089%	Swiss-Prot	strong database homology
`Q5JN42`	Oryza sativa subsp. japonica	Phosphatidylserine decarboxylase proenzyme 2	73.792%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card