LXL04_038679 | RubberDandelionOmics

Gene overview

LXL04_038679

Reference: OH-1004 Chr: Chr09 Coordinates: 47977102-47979648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1725 bp · LXL04_038679|LXL04_038679|OH1004|cDNA

ATGACAATCGCCGGTCTCTCTTCTATCTCCTTCACTCCTCACCACACCTTCCACCACCGTCGCCGTCGTCACCACCTACTCAAATCCACAACCAGGATATCCGCCCAGGTTTCTGTAACAACTCCTCCATCCACAACTCTTCAGCCAAACCTCAAAAAGACAGGAGTTATCGTCGTCGGCGCTGGTCTGGCCGGCTTAGCCGCCGCCAAACGTCTCCATTCCGATAACATTCCCTTCCTCCTTGTCGAAGCCTCTGATGG...

CDS

Download CDS FASTA

1725 bp · LXL04_038679|LXL04_038679|OH1004|CDS

ATGACAATCGCCGGTCTCTCTTCTATCTCCTTCACTCCTCACCACACCTTCCACCACCGTCGCCGTCGTCACCACCTACTCAAATCCACAACCAGGATATCCGCCCAGGTTTCTGTAACAACTCCTCCATCCACAACTCTTCAGCCAAACCTCAAAAAGACAGGAGTTATCGTCGTCGGCGCTGGTCTGGCCGGCTTAGCCGCCGCCAAACGTCTCCATTCCGATAACATTCCCTTCCTCCTTGTCGAAGCCTCTGATGG...

Protein

Download Protein FASTA

574 aa · LXL04_038679|LXL04_038679|OH1004|PROTEIN

MTIAGLSSISFTPHHTFHHRRRRHHLLKSTTRISAQVSVTTPPSTTLQPNLKKTGVIVVGAGLAGLAAAKRLHSDNIPFLLVEASDGVGGRVRTDNVDGFLLDRGFQIFITGYPEARKILDYEALDLQKFYSGAKVYYGGGFHTVADPLRHLADAIQSLTNPIGTIVDKSLIALTRIRVLTQSDDQIFSAEETSTVDLLKRIGFSDSIVDRFFRPFFGGIFFDRDLETTSRLFDFIFKCLALGDNTLPAKGISAIPEQLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038679`
TK1151 ID	TkA04G454850
OH-1004 ID	LXL04_038679
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	65.500
Protein coverage (%)	TK1151 98.750 / OH-1004 83.798 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038679

Location Chr09:47977102-47979648 (+)

Description Similar to PDS: 15-cis-phytoene desaturase, chloroplastic/chromoplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14220`	Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038679 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006779 porphyrin-containing compound biosynthetic process Biological Process

GO:0006782 protoporphyrinogen IX biosynthetic process Biological Process

GO:0006783 heme biosynthetic process Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0016120 carotene biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G14220

bsu:BSU10140

cann:107861625

sly:544073

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · LXL04_038679 · OH-1004

Mitochondrion0.032

Rank 2 · LXL04_038679 · OH-1004

Cytoplasm0.024

Rank 3 · LXL04_038679 · OH-1004

Peroxisome0.018

Rank 4 · LXL04_038679 · OH-1004

Nucleus0.016

Rank 5 · LXL04_038679 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13450.13NAD_binding_858-122 aa

PF01593.31Amino_oxidase63-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038679	`PF13450.13`	NAD_binding_8	58	122	3e-15	57.0
LXL04_038679	`PF01593.31`	Amino_oxidase	63	476	1.1e-49	170.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S9J1`	Arabidopsis thaliana	Protoporphyrinogen oxidase 2, chloroplastic/mitochondrial	26.901%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card