LXL04_038664 | RubberDandelionOmics

Gene overview

LXL04_038664

Reference: OH-1004 Chr: Chr09 Coordinates: 47786074-47787240 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

781 bp · LXL04_038664|LXL04_038664|OH1004|cDNA

ATGACGAAGGCAAGTCGTCGATCGAAGAAGCGCAGAAAATTTCGTAAACAGGAAGCCAATATTAGGGCGAAATGTAAAGCCAGTAAAGAATCACAACCTATTATTAGCCCTAAGGTGAAGAAATACTGGCTACAACGGTACAATCTATTTTCAAAGTACGATGAAGGTATCAAAATGGACGAAGAAGGGTGGTTCTCCGTCACGCCGGAGGAAATCGCAGTCCGCCACGCCCAGCGGAGCATTGCCGGTGGAGTCGTAAT...

CDS

Download CDS FASTA

765 bp · LXL04_038664|LXL04_038664|OH1004|CDS

ATGACGAAGGCAAGTCGTCGATCGAAGAAGCGCAGAAAATTTCGTAAACAGGAAGCCAATATTAGGGCGAAATGTAAAGCCAGTAAAGAATCACAACCTATTATTAGCCCTAAGGTGAAGAAATACTGGCTACAACGGTACAATCTATTTTCAAAGTACGATGAAGGTATCAAAATGGACGAAGAAGGGTGGTTCTCCGTCACGCCGGAGGAAATCGCAGTCCGCCACGCCCAGCGGAGCATTGCCGGTGGAGTCGTAAT...

Protein

Download Protein FASTA

254 aa · LXL04_038664|LXL04_038664|OH1004|PROTEIN

MTKASRRSKKRRKFRKQEANIRAKCKASKESQPIISPKVKKYWLQRYNLFSKYDEGIKMDEEGWFSVTPEEIAVRHAQRSIAGGVVIDCFAGMGGNSIQFAALGYHVIAIDIDPLKVEMASNNAKIYGVDNYIDFIVGDFLQLAPSLKGNVAFLSPPWGGPSYKMTHNFTLDLLKPVDGYTLFQVAQRITPNIIMFLPRNVDVCQVEQLSWLSSPPLNVEIEENYVDGFLKGKTAYFGDVAYWGMTQETNTHTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038664`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_038664`
Location	Chr09:47786074-47787240 (-)
Description	Similar to Tgs1: Trimethylguanosine synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038664` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000387 spliceosomal snRNP assembly Biological Process GO:0001510 RNA methylation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0008033 tRNA processing Biological Process GO:0017126 nucleologenesis Biological Process GO:0022613 ribonucleoprotein complex biogenesis Biological Process GO:0032210 regulation of telomere maintenance via telomerase Biological Process GO:0036261 7-methylguanosine cap hypermethylation Biological Process GO:0042308 negative regulation of protein import into nucleus Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0071333 cellular response to glucose stimulus Biological Process GO:0071398 cellular response to fatty acid Biological Process
KEGG gene cross-reference	hsa:96764 mmu:116940 rno:312947 sce:YPL157W spo:2542015 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.657

Rank 1 · LXL04_038664 · OH-1004

Cytoplasm0.459

Rank 2 · LXL04_038664 · OH-1004

Mitochondrion0.050

Rank 3 · LXL04_038664 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_038664 · OH-1004

Endoplasmic reticulum0.019

Rank 5 · LXL04_038664 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02475.24TRM5-TYW2_MTfase65-149 aa

PF13847.13Methyltransf_3183-144 aa

PF09445.17Methyltransf_1585-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038664	`PF02475.24`	TRM5-TYW2_MTfase	65	149	3e-09	37.7
LXL04_038664	`PF13847.13`	Methyltransf_31	83	144	7.9e-06	26.4
LXL04_038664	`PF09445.17`	Methyltransf_15	85	239	3.1e-39	134.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card