LXL04_038648 | RubberDandelionOmics

Gene overview

LXL04_038648

Reference: OH-1004 Chr: Chr09 Coordinates: 47367867-47368928 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

543 bp · LXL04_038648|LXL04_038648|OH1004|cDNA

ATGGCAACAAAGACCGCCATTCTGATTCTATGCATCTCTGCGTTGGCGATGTACGCGGATTTGGTCGAGTCAGCCCACAACACCGGTGCACCGGCACCAGCGGCGGACTGCTCCACCGTGATACTGAACATGGCAGATTGCCTGTCGTACGTGACGGCCGGCAGCACGGTTAAGAAACCTGAAGGAACTTGTTGCCCTGGGCTGAAATCGGTGTTGAAAACCAACGCACAGTGTTTGTGTGAAGCATTCAAAAACAGCGC...

CDS

Download CDS FASTA

543 bp · LXL04_038648|LXL04_038648|OH1004|CDS

ATGGCAACAAAGACCGCCATTCTGATTCTATGCATCTCTGCGTTGGCGATGTACGCGGATTTGGTCGAGTCAGCCCACAACACCGGTGCACCGGCACCAGCGGCGGACTGCTCCACCGTGATACTGAACATGGCAGATTGCCTGTCGTACGTGACGGCCGGCAGCACGGTTAAGAAACCTGAAGGAACTTGTTGCCCTGGGCTGAAATCGGTGTTGAAAACCAACGCACAGTGTTTGTGTGAAGCATTCAAAAACAGCGC...

Protein

Download Protein FASTA

180 aa · LXL04_038648|LXL04_038648|OH1004|PROTEIN

MATKTAILILCISALAMYADLVESAHNTGAPAPAADCSTVILNMADCLSYVTAGSTVKKPEGTCCPGLKSVLKTNAQCLCEAFKNSAQLGVSLNVTKALALPAACNIKAPSVSNCGMSLGTATAPVQAPMAVGEAPTMAAGLGPAGSLAPSPALGSSNSAVTGMSTGSVFISMILAVYFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038648`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038648

Location Chr09:47367867-47368928 (+)

Description Similar to At5g64080: Non-specific lipid-transfer protein-like protein At5g64080

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64080`	Probable lipid transfer protein (By similarity).	No verified direct reference in this release
`At2g13820`	Probable lipid transfer protein (By similarity).	Expression and genome-wide analysis of the xylogen-type gene family.2011 · DOI: 10.1093/pcp/pcr060
`At1g36150`	Probable lipid transfer protein.	No verified direct reference in this release
`At5g09370`	Probable lipid transfer protein.	No verified direct reference in this release
`At4g08670`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038648 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0010089 xylem development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0008289 lipid binding Molecular Function

KEGG gene cross-reference

ath:AT1G36150

ath:AT2G13820

ath:AT4G08670

ath:AT5G09370

ath:AT5G64080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.738

Rank 1 · LXL04_038648 · OH-1004

Extracellular0.119

Rank 2 · LXL04_038648 · OH-1004

Endoplasmic reticulum0.090

Rank 3 · LXL04_038648 · OH-1004

Cytoplasm0.085

Rank 4 · LXL04_038648 · OH-1004

Nucleus0.031

Rank 5 · LXL04_038648 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_225-115 aa

PF00234.28Tryp_alpha_amyl37-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038648	`PF14368.12`	LTP_2	25	115	8.4e-18	65.0
LXL04_038648	`PF00234.28`	Tryp_alpha_amyl	37	115	7.7e-14	52.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYI9`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 31	55.128%	Swiss-Prot	strong database homology
`Q9ZQI8`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 11	43.956%	Swiss-Prot	moderate database homology
`Q2PE60`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 23	42.963%	Swiss-Prot	moderate database homology
`Q9FY78`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 29	40.152%	Swiss-Prot	moderate database homology
`Q2PE70`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 4	44.860%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card