Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1320 bp · LXL04_038642|LXL04_038642|OH1004|cDNA
ATGATGGGTACCAACGGTAACATTAATAATCATCCCAAAAACaacaagaacaagaagaagaacaagCGCGGCGGAACGAAGAAAAGGATGACGGTGGAACAATCTCTTGCTTACAAATCCGTAAGTGAATGGGTTTACTTGGACACCATACCTTCGTCCGCCAATTCCGCAATCGCCATCGACGATGATTTTAAGGTGAAGTTGGTGCACACCAAGGTTTCCGCTGAAAAATTGGTGTTCGAATTGCATTCTCATTCGAT...
1320 bp · LXL04_038642|LXL04_038642|OH1004|CDS
ATGATGGGTACCAACGGTAACATTAATAATCATCCCAAAAACAACAAGAACAAGAAGAAGAACAAGCGCGGCGGAACGAAGAAAAGGATGACGGTGGAACAATCTCTTGCTTACAAATCCGTAAGTGAATGGGTTTACTTGGACACCATACCTTCGTCCGCCAATTCCGCAATCGCCATCGACGATGATTTTAAGGTGAAGTTGGTGCACACCAAGGTTTCCGCTGAAAAATTGGTGTTCGAATTGCATTCTCATTCGAT...
Protein
Download Protein FASTA439 aa · LXL04_038642|LXL04_038642|OH1004|PROTEIN
MMGTNGNINNHPKNNKNKKKNKRGGTKKRMTVEQSLAYKSVSEWVYLDTIPSSANSAIAIDDDFKVKLVHTKVSAEKLVFELHSHSICSDGFLSPSKLVERAHQYGVKVLSLTDHDTMAGIPQALEAARRVGIKIIPGVEISTIFTPRTESGSEEPVHVLAYYSCCGPSNFEKLDQFLGNIREGRYLRAKNMIAKLNKLKLPLRWESVEKIAGDGVAPGRVHVARAMVEAGHVENLKQAFSRYLYDGGPAYSTGSEPDAD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_038642 |
|---|---|
| TK1151 ID | TkA04G452570 |
| OH-1004 ID | LXL04_038642 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 30.979Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_038642 |
|---|---|
| Location | Chr09:47127893-47129695 (-) |
| Description | Similar to HI_1400: 5'-3' exoribonuclease (Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000470 maturation of LSU-rRNA Biological Process GO:0000481 maturation of 5S rRNA Biological Process GO:0006364 rRNA processing Biological Process GO:0016311 dephosphorylation Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0000166 nucleotide binding Molecular Function GO:0004534 5'-3' RNA exonuclease activity Molecular Function GO:0008252 nucleotidase activity Molecular Function GO:0030145 manganese ion binding Molecular Function GO:0035312 5'-3' DNA exonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0097657 3',5'-nucleotide bisphosphate phosphatase activity Molecular Function |
| KEGG gene cross-reference | cvi:CV_1693 ecj:JW1258 eco:b1266 ecoc:C3026_07420 ele:Elen_0235 hin:HI_1400 stm:STM1721 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02811.27PHP81-155 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_038642 | PF02811.27 | PHP | 81 | 155 | 2.5e-13 | 51.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.