LXL04_038604 | RubberDandelionOmics

Gene overview

LXL04_038604

Reference: OH-1004 Chr: Chr09 Coordinates: 45006527-45007438 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_038604|LXL04_038604|OH1004|cDNA

ATGGCACGTAATTACCAAACTGCCACTCTTCTTATCTTCCTGCTCACCATTTCTGTTTTCCAGAAATCTTTCTCTGTACTCGTCAAAGAGCAGCCCCTTCTGCTCAAATACCACAACGGCGCCCTTCTCCGAGGTCCGGTCACCGTCAATCTTGTTTGGTACGGCAAGTTTACACCAACCCAGCGTTCCGTAATCGTCGATTTCTTACAGTCTCTCAACACCGTGAAGGGAGCACGAAAGGCGGCGACGCCGCTTCCCTC...

CDS

Download CDS FASTA

912 bp · LXL04_038604|LXL04_038604|OH1004|CDS

ATGGCACGTAATTACCAAACTGCCACTCTTCTTATCTTCCTGCTCACCATTTCTGTTTTCCAGAAATCTTTCTCTGTACTCGTCAAAGAGCAGCCCCTTCTGCTCAAATACCACAACGGCGCCCTTCTCCGAGGTCCGGTCACCGTCAATCTTGTTTGGTACGGCAAGTTTACACCAACCCAGCGTTCCGTAATCGTCGATTTCTTACAGTCTCTCAACACCGTGAAGGGAGCACGAAAGGCGGCGACGCCGCTTCCCTC...

Protein

Download Protein FASTA

303 aa · LXL04_038604|LXL04_038604|OH1004|PROTEIN

MARNYQTATLLIFLLTISVFQKSFSVLVKEQPLLLKYHNGALLRGPVTVNLVWYGKFTPTQRSVIVDFLQSLNTVKGARKAATPLPSVSSWWKITEKYHNGSSTTVVGKQILDENYSLGKFLKNYHIQYLATKVAKPNSINVVLTGKEVGVERFCTSRCGTHGATKGKPRVAYAWVGNSETQCPGQCAWPFHQPIYGPQSPPLISPNGDVGVDGMVINLATVIAGAVTNPFNQGYFQGPATAPLEAVSACTGMFGSGSYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038604`
TK1151 ID	TkA04G446200
OH-1004 ID	LXL04_038604
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038604

Location Chr09:45006527-45007438 (-)

Description Similar to EXL2: Protein EXORDIUM-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64260`	May play a role in a brassinosteroid-dependent regulation of growth and development.	No verified direct reference in this release
`At4g08950`	Required for cell expansion in leaves.	No verified direct reference in this release
`At5g09440`	May play a role in a brassinosteroid-dependent regulation of growth and development.	No verified direct reference in this release
`At1g35140`	May play a role in a brassinosteroid-dependent regulatory pathway that controls growth and development under low carbon and energy availability.	EXORDIUM-LIKE1 promotes growth during low carbon availability in Arabidopsis.2011 · DOI: 10.1104/pp.111.177204

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038604 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G35140

ath:AT4G08950

ath:AT5G09440

ath:AT5G64260

nta:107822731

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.563

Rank 1 · LXL04_038604 · OH-1004

Cell membrane0.102

Rank 2 · LXL04_038604 · OH-1004

Nucleus0.056

Rank 3 · LXL04_038604 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_038604 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_038604 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04674.18Phi_135-302 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038604	`PF04674.18`	Phi_1	35	302	1e-120	403.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FE06`	Arabidopsis thaliana	Protein EXORDIUM-like 2	67.638%	Swiss-Prot	strong database homology
`Q9ZPE7`	Arabidopsis thaliana	Protein EXORDIUM	56.522%	Swiss-Prot	strong database homology
`Q9FY71`	Arabidopsis thaliana	Protein EXORDIUM-like 4	57.190%	Swiss-Prot	strong database homology
`Q9C6E4`	Arabidopsis thaliana	Protein EXORDIUM-like 1	56.989%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card