Gene Card
Gene overview
cDNA / CDS / Protein Sequences
828 bp · LXL04_038533|LXL04_038533|OH1004|cDNA
ATGCTCATACTTCTAATATGCAGGCCAATTAAAACCACAACTATGTCTAGAAGACCAACAGGTTTATCTAGGCGATTGGGGGATGGAGCCAGCATTCCATTTATGGGATCTTTACACCCAAAATCACGCCCATCACCTTTCTTATCCATTGGACTTGTAGTAGTGGGAGCTTTTCTCATAATTGGATATCTTTACAGCAGTTCAGGTGGCAACAGTTATGATAAAGCTACTTTAACTAGACTTGAAGGTGGTGGTTCATG...
828 bp · LXL04_038533|LXL04_038533|OH1004|CDS
ATGCTCATACTTCTAATATGCAGGCCAATTAAAACCACAACTATGTCTAGAAGACCAACAGGTTTATCTAGGCGATTGGGGGATGGAGCCAGCATTCCATTTATGGGATCTTTACACCCAAAATCACGCCCATCACCTTTCTTATCCATTGGACTTGTAGTAGTGGGAGCTTTTCTCATAATTGGATATCTTTACAGCAGTTCAGGTGGCAACAGTTATGATAAAGCTACTTTAACTAGACTTGAAGGTGGTGGTTCATG...
Protein
Download Protein FASTA275 aa · LXL04_038533|LXL04_038533|OH1004|PROTEIN
MLILLICRPIKTTTMSRRPTGLSRRLGDGASIPFMGSLHPKSRPSPFLSIGLVVVGAFLIIGYLYSSSGGNSYDKATLTRLEGGGSCTSEIFQALPYLKKAYGDSMHKILHVGPDTCAVVSNLLKEEDTEAWGVEPYDLDDSDASCKSLVRRGTVRVADIKFSLPYRSKSFSLVIVSDALDYLSPKYLNKTLPELARVSSDGFIIFSGYPGQSKFKGAELAKFGRPAKLRSASWWIRFFVQSRIEENEEAVKKFELGAAT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_038533 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_038533 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr09:43423189-43424857 (-) | |||||||||
| Description | Similar to CGR2: Probable pectin methylesterase CGR2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009664 plant-type cell wall organization Biological Process GO:0009832 plant-type cell wall biogenesis Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010394 homogalacturonan metabolic process Biological Process GO:0015976 carbon utilization Biological Process GO:0032259 methylation Biological Process GO:0045488 pectin metabolic process Biological Process GO:0045489 pectin biosynthetic process Biological Process GO:0048639 positive regulation of developmental growth Biological Process GO:0051512 positive regulation of unidimensional cell growth Biological Process GO:1903942 positive regulation of respiratory gaseous exchange Biological Process GO:1905157 positive regulation of photosynthesis Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G49720 ath:AT5G65810 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.