LXL04_038459 | RubberDandelionOmics

Gene overview

LXL04_038459

Reference: OH-1004 Chr: Chr09 Coordinates: 41531964-41533172 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · LXL04_038459|LXL04_038459|OH1004|cDNA

ATGAAAACCAGAGATGATAGAAGTCAAGAAACCCCAGATGTTCATAAAAAAGAGTGGTTGAATCTTAGCCTAGGACAAAACGTAGGTGAAAGTTCACATCCAAAACCCATGAAGGTATACACGTGCAACTTCTGTAAGAGAAACTTCTACAACTCACAAGCATTAGGTGGTCATCAGAATGCACACAAGAGGGAGAGAGATGCCGCTAGAAGATTCCATTCACCAAAAACGATTACCAGCTTTTCTAGAAGCTTCTGGGG...

CDS

Download CDS FASTA

708 bp · LXL04_038459|LXL04_038459|OH1004|CDS

ATGAAAACCAGAGATGATAGAAGTCAAGAAACCCCAGATGTTCATAAAAAAGAGTGGTTGAATCTTAGCCTAGGACAAAACGTAGGTGAAAGTTCACATCCAAAACCCATGAAGGTATACACGTGCAACTTCTGTAAGAGAAACTTCTACAACTCACAAGCATTAGGTGGTCATCAGAATGCACACAAGAGGGAGAGAGATGCCGCTAGAAGATTCCATTCACCAAAAACGATTACCAGCTTTTCTAGAAGCTTCTGGGG...

Protein

Download Protein FASTA

235 aa · LXL04_038459|LXL04_038459|OH1004|PROTEIN

MKTRDDRSQETPDVHKKEWLNLSLGQNVGESSHPKPMKVYTCNFCKRNFYNSQALGGHQNAHKRERDAARRFHSPKTITSFSRSFWGHRSLGVQTHSLGETTTKNGETSVARFVDNGTRYGVSWGQMYHGEETVELKWPGGFYLDSQQVSQPSDQHILDLNLKLVIGVGAFSSGWVGRIRRQPNLRYRVSRGGARDGFKVVVKSRRMKEMKRVSAGSGRWQLPPDGFVEGDIEHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038459`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038459

Location Chr09:41531964-41533172 (+)

Description Similar to ZFP7: Zinc finger protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24625`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At5g25160`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At5g14010`	May function as a transcriptional repressor of cellular proliferation that regulates floral determinacy and relative size of basal pattern elements along the proximo-distal axis of the developing gynoecium.	No verified direct reference in this release
`At1g66140`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g80730`	May play a role in the regulation of shoot development, downstream of photomorphogenic activation (Probable).	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294 Expression analysis of an Arabidopsis C2H2 zinc finger protein gene.1996 · DOI: 10.1007/bf00020477

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038459 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G24625

ath:AT1G66140

ath:AT1G80730

ath:AT5G14010

ath:AT5G25160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.914

Rank 1 · LXL04_038459 · OH-1004

Cytoplasm0.140

Rank 2 · LXL04_038459 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_038459 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_038459 · OH-1004

Mitochondrion0.015

Rank 5 · LXL04_038459 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39266`	Arabidopsis thaliana	Zinc finger protein 7	30.973%	Swiss-Prot	moderate database homology
`Q39262`	Arabidopsis thaliana	Zinc finger protein 3	35.200%	Swiss-Prot	weak database homology
`Q9FFX4`	Arabidopsis thaliana	Zinc finger protein KNUCKLES	65.000%	Swiss-Prot	weak database homology
`Q39263`	Arabidopsis thaliana	Zinc finger protein 4	30.435%	Swiss-Prot	weak database homology
`Q42485`	Arabidopsis thaliana	Zinc finger protein 1	70.588%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card