LXL04_038415 | RubberDandelionOmics

Gene overview

LXL04_038415

Reference: OH-1004 Chr: Chr09 Coordinates: 40213831-40218480 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1455 bp · LXL04_038415|LXL04_038415|OH1004|cDNA

ATGGGCATCGAGAATGAGAACGATGAACCATTAACGCCGGCCGGCCGGCTGTTCGTACAGCCAGCGACTCACCAAATCATCAACTGCGCGCTTGGGCTTGAGCGTCCGATCGGAATTGATGAAGTCCGCAGCGTCCTCTCCGATTCTCTAATGATCAAGCACCCTAGATTTTCCAGCCTCTTAGTCACGGACAATCACGGCCGTGAATATTGGCGAAAAACCGAACTCGAAATCGACCGCCACATCATCCTACATTCCGA...

CDS

Download CDS FASTA

1455 bp · LXL04_038415|LXL04_038415|OH1004|CDS

ATGGGCATCGAGAATGAGAACGATGAACCATTAACGCCGGCCGGCCGGCTGTTCGTACAGCCAGCGACTCACCAAATCATCAACTGCGCGCTTGGGCTTGAGCGTCCGATCGGAATTGATGAAGTCCGCAGCGTCCTCTCCGATTCTCTAATGATCAAGCACCCTAGATTTTCCAGCCTCTTAGTCACGGACAATCACGGCCGTGAATATTGGCGAAAAACCGAACTCGAAATCGACCGCCACATCATCCTACATTCCGA...

Protein

Download Protein FASTA

484 aa · LXL04_038415|LXL04_038415|OH1004|PROTEIN

MGIENENDEPLTPAGRLFVQPATHQIINCALGLERPIGIDEVRSVLSDSLMIKHPRFSSLLVTDNHGREYWRKTELEIDRHIILHSDPVGEADDDETAVNDYLADLSVSTPLSDDKPLWEIHLLSAHKALVMRIHHALGDGTSILSLTLTLFRKLNDPEQSPTTEPLISSSRTPRRLKTGEKVLKLLKMIWFTLIYLFEFIARALWVKDGKTVVRGGEGVEMWPRKLSTAKLSLEDMKTVKNIVANATINDVLFGIISLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038415`
TK1151 ID	TkA04G426180
OH-1004 ID	LXL04_038415
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.400
Protein coverage (%)	TK1151 99.196 / OH-1004 81.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038415

Location Chr09:40213831-40218480 (+)

Description Similar to WSD1: O-acyltransferase WSD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49200`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	No verified direct reference in this release
`At3g49190`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	No verified direct reference in this release
`At5g16350`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	No verified direct reference in this release
`At3g49210`	Bifunctional wax ester synthase/diacylglycerol acyltransferase that uses acyl-CoAs with 16, 18 and 20 carbons as substrates, preferably in combination with 16:0ol alcohol.	Surface wax esters contribute to drought tolerance in Arabidopsis.2019 · DOI: 10.1111/tpj.14269

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038415 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004144 diacylglycerol O-acyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AAZ08051

ath:AT3G49190

ath:AT3G49200

ath:AT3G49210

ath:AT5G16350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.632

Rank 1 · LXL04_038415 · OH-1004

Golgi apparatus0.140

Rank 2 · LXL04_038415 · OH-1004

Cell membrane0.120

Rank 3 · LXL04_038415 · OH-1004

Cytoplasm0.093

Rank 4 · LXL04_038415 · OH-1004

Nucleus0.091

Rank 5 · LXL04_038415 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03007.22WS_DGAT_cat55-252 aa

PF06974.19WS_DGAT_C333-478 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038415	`PF03007.22`	WS_DGAT_cat	55	252	8.5e-11	42.8
LXL04_038415	`PF06974.19`	WS_DGAT_C	333	478	2.5e-44	151.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3B2`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 5	33.671%	Swiss-Prot	moderate database homology
`Q9M3B3`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 4	33.733%	Swiss-Prot	moderate database homology
`Q9FFE8`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 8	33.265%	Swiss-Prot	moderate database homology
`Q9M3B1`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 6	32.400%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card