LXL04_038384 | RubberDandelionOmics

Gene overview

LXL04_038384

Reference: OH-1004 Chr: Chr09 Coordinates: 39409463-39413595 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · LXL04_038384|LXL04_038384|OH1004|cDNA

ATGGCGATTGCTCCCCAGTCTAAACCCACCAACACAAGCCCTCTGACTTCCAAGAGAAAGGCAACGGAGATTAAGAAGAAAGCTTTACAGAAAAAGCCGACAAATTCTAAGCAAAAGGTGAGTTTCGATCTCAAACACAACATAGTAGTAAGCTATGACCCGAAGACAGCTCATTTGTCCCAACCTCCTAATTCGCAAGCCAAATCCGCTGCTATTGAACGAGCTATGGAGGTTCAAGCAAGCCTCCCATCAGAGTTTCC...

CDS

Download CDS FASTA

1527 bp · LXL04_038384|LXL04_038384|OH1004|CDS

ATGGCGATTGCTCCCCAGTCTAAACCCACCAACACAAGCCCTCTGACTTCCAAGAGAAAGGCAACGGAGATTAAGAAGAAAGCTTTACAGAAAAAGCCGACAAATTCTAAGCAAAAGGTGAGTTTCGATCTCAAACACAACATAGTAGTAAGCTATGACCCGAAGACAGCTCATTTGTCCCAACCTCCTAATTCGCAAGCCAAATCCGCTGCTATTGAACGAGCTATGGAGGTTCAAGCAAGCCTCCCATCAGAGTTTCC...

Protein

Download Protein FASTA

508 aa · LXL04_038384|LXL04_038384|OH1004|PROTEIN

MAIAPQSKPTNTSPLTSKRKATEIKKKALQKKPTNSKQKVSFDLKHNIVVSYDPKTAHLSQPPNSQAKSAAIERAMEVQASLPSEFPSFVKPMLPSHVTGGFWLGFPKKFCDVHLPKQDEMVVLVDEDDHEFDTKYLVDKTGLSGGWRGFSIAHKLLEGDALVFQLIKNWKFKVYIVRVNGLNEIDGALGLLNLVPTQIEKVRDEDMDIDLHEDHSLVVFDQSEATEGLRFSQSVIEFKNIKSIKDFNIVVDDLIIDSEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038384`
TK1151 ID	TkAUNG030580
OH-1004 ID	LXL04_038384
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 72.263 / OH-1004 19.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038384

Location Chr09:39409463-39413595 (+)

Description Similar to Os01g0234100: B3 domain-containing protein Os01g0234100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19184`	B3 domain-containing protein At3g19184.	No verified direct reference in this release
`At5g42700`	B3 domain-containing protein At5g42700.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0234100`	B3 domain-containing protein Os01g0234100.	No verified direct reference in this release
`Os06g0194400`	B3 domain-containing protein Os06g0194400.	No verified direct reference in this release
`Os03g0184500`	B3 domain-containing protein Os03g0184500.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038384 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G19184

dosa:Os01g0234100

dosa:Os03g0184500

dosa:Os06g0194400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · LXL04_038384 · OH-1004

Cytoplasm0.112

Rank 2 · LXL04_038384 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_038384 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_038384 · OH-1004

Plastid0.013

Rank 5 · LXL04_038384 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B389-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038384	`PF02362.27`	B3	89	178	4.6e-16	59.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3M3`	Arabidopsis thaliana	B3 domain-containing protein At3g19184	57.724%	Swiss-Prot	weak database homology
`Q9FMZ4`	Arabidopsis thaliana	B3 domain-containing protein At5g42700	41.209%	Swiss-Prot	weak database homology
`Q0JP99`	Oryza sativa subsp. japonica	B3 domain-containing protein Os01g0234100	40.270%	Swiss-Prot	moderate database homology
`Q69V36`	Oryza sativa subsp. japonica	B3 domain-containing protein Os06g0194400	52.866%	Swiss-Prot	weak database homology
`Q10QS9`	Oryza sativa subsp. japonica	B3 domain-containing protein Os03g0184500	55.738%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card