Gene Card
Gene overview
cDNA / CDS / Protein Sequences
651 bp · LXL04_038281|LXL04_038281|OH1004|cDNA
ATGTCGATCGAAAAAGAGGAGATAGGGTTCACTGGATCAGCGGGCTCATCGGGGCCACCACCTCCCACCATGCAGTTAGATCCAGAAAACGTTGTGGCACTTGGAATTGTGGGTTTGAAATCAAATGAAGTTGCCTACACAATACTAGACTGCAATTTTGGCGTTTTTGGCGACTTCACTCAATGGCTGCTATTTACATGGGTGGCCAAATTCCTCAAAATGTCTTACATGGATGATGGCTGCTATTTAAATGCTGCTAG...
651 bp · LXL04_038281|LXL04_038281|OH1004|CDS
ATGTCGATCGAAAAAGAGGAGATAGGGTTCACTGGATCAGCGGGCTCATCGGGGCCACCACCTCCCACCATGCAGTTAGATCCAGAAAACGTTGTGGCACTTGGAATTGTGGGTTTGAAATCAAATGAAGTTGCCTACACAATACTAGACTGCAATTTTGGCGTTTTTGGCGACTTCACTCAATGGCTGCTATTTACATGGGTGGCCAAATTCCTCAAAATGTCTTACATGGATGATGGCTGCTATTTAAATGCTGCTAG...
Protein
Download Protein FASTA216 aa · LXL04_038281|LXL04_038281|OH1004|PROTEIN
MSIEKEEIGFTGSAGSSGPPPPTMQLDPENVVALGIVGLKSNEVAYTILDCNFGVFGDFTQWLLFTWVAKFLKMSYMDDGCYLNAARMRFTYEGNPYCLNLIDTLGHVDFFYEVSRSLAACEGALLVVDASQLDPENVVALGIVCLKSNEVAYTVLDSNFGVFGDFTQWLLFTWVAKFLKLSYMDDGCYLNGLNPLMFVFALIANATYVGKWAISV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_038281 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_038281 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr09:36415707-36421577 (-) | ||||||||||||
| Description | Similar to RCOM_1767360: Translation factor GUF1 homolog, chloroplastic | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006412 translation Biological Process GO:0045727 positive regulation of translation Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0003729 mRNA binding Molecular Function GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function GO:0019904 protein domain specific binding Molecular Function GO:0043022 ribosome binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT5G08650 pop:7465026 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00009.34GTP_EFTU90-132 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_038281 | PF00009.34 | GTP_EFTU | 90 | 132 | 1.8e-11 | 44.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.