LXL04_038272 | RubberDandelionOmics

Gene overview

LXL04_038272

Reference: OH-1004 Chr: Chr09 Coordinates: 36205861-36209492 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_038272|LXL04_038272|OH1004|cDNA

ATGTGCGGAAGTGGAGGTGGCGGTGGGGAGGAGGCGGTGGCGGAGGGCGGTTTGAGGAATGAGCAGACGTGGAACAGAGTGTGGAAGGAGGAAGAAGATTCATGGCTGGAGAGGGACCCGCTGGTGGTTGGACGTGTGATAGGAGATGTTCTTGACAGTTTCACAAAATCGATTAACCTTTCTATATCATACAACAATAGGGAAGTTAACAATGGGTGCGAGCTAAAACCCTCTCAAGTGGTAAACCAACCTAGGGTTGA...

CDS

Download CDS FASTA

624 bp · LXL04_038272|LXL04_038272|OH1004|CDS

ATGTGCGGAAGTGGAGGTGGCGGTGGGGAGGAGGCGGTGGCGGAGGGCGGTTTGAGGAATGAGCAGACGTGGAACAGAGTGTGGAAGGAGGAAGAAGATTCATGGCTGGAGAGGGACCCGCTGGTGGTTGGACGTGTGATAGGAGATGTTCTTGACAGTTTCACAAAATCGATTAACCTTTCTATATCATACAACAATAGGGAAGTTAACAATGGGTGCGAGCTAAAACCCTCTCAAGTGGTAAACCAACCTAGGGTTGA...

Protein

Download Protein FASTA

207 aa · LXL04_038272|LXL04_038272|OH1004|PROTEIN

MCGSGGGGGEEAVAEGGLRNEQTWNRVWKEEEDSWLERDPLVVGRVIGDVLDSFTKSINLSISYNNREVNNGCELKPSQVVNQPRVDIGGDDLRDFHTLIMVDPDAPSPSNPNLREYLHWLVTDIPATTGARFGQEVVCYESPRPSRGIHRLAFVLFRQMGRQTVYAPGWRQNFNTKDFAELYNLGSPVAAVYFNCQRECGLGGQRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038272`
TK1151 ID	TkA04G413030
OH-1004 ID	LXL04_038272
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.276 / OH-1004 82.609 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038272

Location Chr09:36205861-36209492 (-)

Description Similar to HD3A: Protein HEADING DATE 3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65480`	Component of the mobile flower-promoting signal (floral stimulus or florigen).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0157700`	Probable mobile flower-promoting signal (florigen) that moves from the leaf to the shoot apical meristem (SAM) and induces flowering.	Hd3a, a rice ortholog of the Arabidopsis FT gene, promotes transition to flowering downstream of Hd1 under short-day conditions.2002 · DOI: 10.1093/pcp/pcf156 Hd3a protein is a mobile flowering signal in rice.2007 · DOI: 10.1126/science.1141753 Hd3a and RFT1 are essential for flowering in rice.2008 · DOI: 10.1242/dev.008631 A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice.2009 · DOI: 10.1242/dev.040170
`Os06g0157500`	Probable mobile flower-promoting signal (florigen) that moves from the leaf to the shoot apical meristem (SAM) and induces flowering.	Hd3a and RFT1 are essential for flowering in rice.2008 · DOI: 10.1242/dev.008631 A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice.2009 · DOI: 10.1242/dev.040170 OsFTIP1-Mediated Regulation of Florigen Transport in Rice Is Negatively Regulated by the Ubiquitin-Like Domain Kinase OsUbDKγ4.2017 · DOI: 10.1105/tpc.16.00728

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038272 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010022 meristem determinacy Biological Process

GO:0010048 vernalization response Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010229 inflorescence development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048572 short-day photoperiodism Biological Process

KEGG gene cross-reference

ath:AT1G65480

bdi:100831221

bdi:100838275

dosa:Os06g0157500

dosa:Os06g0157700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · LXL04_038272 · OH-1004

Nucleus0.410

Rank 2 · LXL04_038272 · OH-1004

Mitochondrion0.154

Rank 3 · LXL04_038272 · OH-1004

Cell membrane0.094

Rank 4 · LXL04_038272 · OH-1004

Endoplasmic reticulum0.074

Rank 5 · LXL04_038272 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01161.27PBP96-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038272	`PF01161.27`	PBP	96	180	6.4e-13	50.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXZ2`	Arabidopsis thaliana	Protein FLOWERING LOCUS T	72.781%	Swiss-Prot	strong database homology
`Q93WI9`	Oryza sativa subsp. japonica	Protein HEADING DATE 3A	78.235%	Swiss-Prot	strong database homology
`Q8VWH2`	Oryza sativa subsp. japonica	Protein RICE FLOWERING LOCUS T 1	77.976%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card