LXL04_037988 | RubberDandelionOmics

Gene overview

LXL04_037988

Reference: OH-1004 Chr: Chr09 Coordinates: 27564080-27572140 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · LXL04_037988|LXL04_037988|OH1004|cDNA

ATGTCAACGACCTCGTCTTCTTCGTCACAGGACGGAGGAGACGGTGGAAATGGCGGTGGTGGAGAGTTCGAAGGACCGTCGCATTCTCGTCAACGCTTCAACCACGCTGTATGGCCGGAGCCTTTCCTCGAAGCTTTAGCTACTCAAATCGCTATCGACGCCGCGCGCACATTTGGCCGCCTCGCCGTTGCTCCTGCTCTCACGAATCTCTTCCAGGTTTGTAGAACATGGCGAACTGTATCTCAGTCTGACCTCCTATG...

CDS

Download CDS FASTA

1323 bp · LXL04_037988|LXL04_037988|OH1004|CDS

ATGTCAACGACCTCGTCTTCTTCGTCACAGGACGGAGGAGACGGTGGAAATGGCGGTGGTGGAGAGTTCGAAGGACCGTCGCATTCTCGTCAACGCTTCAACCACGCTGTATGGCCGGAGCCTTTCCTCGAAGCTTTAGCTACTCAAATCGCTATCGACGCCGCGCGCACATTTGGCCGCCTCGCCGTTGCTCCTGCTCTCACGAATCTCTTCCAGGTTTGTAGAACATGGCGAACTGTATCTCAGTCTGACCTCCTATG...

Protein

Download Protein FASTA

440 aa · LXL04_037988|LXL04_037988|OH1004|PROTEIN

MSTTSSSSSQDGGDGGNGGGGEFEGPSHSRQRFNHAVWPEPFLEALATQIAIDAARTFGRLAVAPALTNLFQVCRTWRTVSQSDLLWQTLTRRIWHRNNLLHPTWHDEYIYRHRTATNFRRRRYIYTTLHFPPNENNTNESLSCHRLALSDYHLAAGFSDGSVCLFHLPTRLHVSTFHPHQRNHLGPFSRAVCGLFFSDNRLIFASLDGDIHVASVNVPGATRRAHLGDVVTDGVLVDFAGCNQWWVGLYAGIPNRAFHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037988`
TK1151 ID	TkA04G372420
OH-1004 ID	LXL04_037988
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 94.737 / OH-1004 69.545 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037988

Location Chr09:27564080-27572140 (+)

Description Similar to SAP: Transcriptional regulator STERILE APETALA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35770`	Transcriptional regulator involved in the specification of floral identity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037988 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009908 flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0046622 positive regulation of organ growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT5G35770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · LXL04_037988 · OH-1004

Nucleus0.443

Rank 2 · LXL04_037988 · OH-1004

Cell membrane0.054

Rank 3 · LXL04_037988 · OH-1004

Mitochondrion0.051

Rank 4 · LXL04_037988 · OH-1004

Endoplasmic reticulum0.043

Rank 5 · LXL04_037988 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKH1`	Arabidopsis thaliana	Transcriptional regulator STERILE APETALA	52.860%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card