LXL04_037919 | RubberDandelionOmics

Gene overview

LXL04_037919

Reference: OH-1004 Chr: Chr09 Coordinates: 25402987-25403551 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

365 bp · LXL04_037919|LXL04_037919|OH1004|cDNA

ATGGCGAAGCAAAAGATTGTAGTGAAGGTGACAATGACCAACGAAAATAAAATCCATAAGGCTCTGAAGATCGCCGTTAGTCTCTCCGGTGTGGAATCGGCGTCTTTCGTTGGTTCGGATAAAACCCAGATCGCTGTTACCGAGGAAGATGTTGACTCGGTGGAACTCACGACGTTGCTAAGGAAAAGTGTAGGATACACAGAGCTGGTGAGTGTTGGTCCGGTGGAGGAGAAGAAACCTGCCGCCGCCAATGAAAAGAA...

CDS

Download CDS FASTA

342 bp · LXL04_037919|LXL04_037919|OH1004|CDS

ATGGCGAAGCAAAAGATTGTAGTGAAGGTGACAATGACCAACGAAAATAAAATCCATAAGGCTCTGAAGATCGCCGTTAGTCTCTCCGGTGTGGAATCGGCGTCTTTCGTTGGTTCGGATAAAACCCAGATCGCTGTTACCGAGGAAGATGTTGACTCGGTGGAACTCACGACGTTGCTAAGGAAAAGTGTAGGATACACAGAGCTGGTGAGTGTTGGTCCGGTGGAGGAGAAGAAACCTGCCGCCGCCAATGAAAAGAA...

Protein

Download Protein FASTA

113 aa · LXL04_037919|LXL04_037919|OH1004|PROTEIN

MAKQKIVVKVTMTNENKIHKALKIAVSLSGVESASFVGSDKTQIAVTEEDVDSVELTTLLRKSVGYTELVSVGPVEEKKPAAANEKKPTAAPLFVNPYEYYYGNYGMPYYEYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037919`
TK1151 ID	TkA04G361590
OH-1004 ID	LXL04_037919
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037919

Location Chr09:25402987-25403551 (-)

Description Similar to HIPP16: Heavy metal-associated isoprenylated plant protein 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07600`	Probable heavy-metal-binding protein.	No verified direct reference in this release
`At5g48290`	Probable heavy-metal-binding protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: F7J0N2`	Disease resistance (R) protein that recognizes the AVR-Pia and AVR1-CO39 effector avirulence proteins from M.oryzae.	No verified direct reference in this release
`UniProt: F2VYU4`	Disease resistance (R) protein that specifically recognizes the AVR-Pik effector avirulence protein from M.oryzae.	No verified direct reference in this release
`UniProt: B5UBC1`	Disease resistance (R) protein that specifically recognizes the AVR-Pik effector avirulence protein from M.oryzae.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037919 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051707 response to other organism Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G07600

ath:AT5G48290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.648

Rank 1 · LXL04_037919 · OH-1004

Nucleus0.326

Rank 2 · LXL04_037919 · OH-1004

Cell membrane0.167

Rank 3 · LXL04_037919 · OH-1004

Mitochondrion0.054

Rank 4 · LXL04_037919 · OH-1004

Extracellular0.053

Rank 5 · LXL04_037919 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSF0`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 16	42.857%	Swiss-Prot	moderate database homology
`Q5PNZ7`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 46	43.529%	Swiss-Prot	moderate database homology
`F7J0N2`	Oryza sativa subsp. japonica	Disease resistance protein RGA5	36.634%	Swiss-Prot	moderate database homology
`F2VYU4`	Oryza sativa subsp. japonica	Disease resistance protein Pik-1	36.486%	Swiss-Prot	moderate database homology
`B5UBC1`	Oryza sativa subsp. japonica	Disease resistance protein Pikm1-TS	35.135%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card