LXL04_037887 | RubberDandelionOmics

Gene overview

LXL04_037887

Reference: OH-1004 Chr: Chr09 Coordinates: 24447568-24451325 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1440 bp · LXL04_037887|LXL04_037887|OH1004|cDNA

ATGGGATTGGGGAAGAGATGCAGAGCAGCAGTTGTGGTACTTGGTGATATTGGTCGCAGTCCGCGTATGCAATACCATGCCCTCTCTCTTGCTCGTCAGGCAGATTTTGAGGTGGATATTGTTGCATATGGAGGTTCAGACCCACATTCTGCTCTATTAGAGAACAAATCTATACATATTCACACAATGAGGCAATGGCCATCAAGAGCTGGGATTTTACCTAAAATATTTCGTCCCTTGATGCTTTTACTAAAGCCCTT...

CDS

Download CDS FASTA

1440 bp · LXL04_037887|LXL04_037887|OH1004|CDS

ATGGGATTGGGGAAGAGATGCAGAGCAGCAGTTGTGGTACTTGGTGATATTGGTCGCAGTCCGCGTATGCAATACCATGCCCTCTCTCTTGCTCGTCAGGCAGATTTTGAGGTGGATATTGTTGCATATGGAGGTTCAGACCCACATTCTGCTCTATTAGAGAACAAATCTATACATATTCACACAATGAGGCAATGGCCATCAAGAGCTGGGATTTTACCTAAAATATTTCGTCCCTTGATGCTTTTACTAAAGCCCTT...

Protein

Download Protein FASTA

479 aa · LXL04_037887|LXL04_037887|OH1004|PROTEIN

MGLGKRCRAAVVVLGDIGRSPRMQYHALSLARQADFEVDIVAYGGSDPHSALLENKSIHIHTMRQWPSRAGILPKIFRPLMLLLKPLIQFITLLWFLCVKIKAPDVFLVQNPPSVPTLVAVKWASWLRRSSFIIDWHNFGYTLLALSLGRSSRFVSVYHWVELHFGKMANGCLCVTKAMQHELDQVWGIKATVLYDQPPEFFRPALLEEKHKLFCRIKKDMFRSNSPIDCISYGITSKHIQDPNTTIFTNQIGENYHLKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037887`
TK1151 ID	TkA04G358430
OH-1004 ID	LXL04_037887
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037887

Location Chr09:24447568-24451325 (+)

Description Similar to TUN: UDP-glycosyltransferase TURAN

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16570`	Required for pollen tube (PT) growth and integrity by affecting the stability of the pollen-specific ANX1 and ANX2 proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037887 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0048868 pollen tube development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0016020 membrane Cellular Component

GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component

GO:0000030 mannosyltransferase activity Molecular Function

GO:0004578 chitobiosyldiphosphodolichol beta-mannosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G16570

ddi:DDB_G0286011

hsa:56052

mmu:208211

pon:100173370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.378

Rank 1 · LXL04_037887 · OH-1004

Golgi apparatus0.295

Rank 2 · LXL04_037887 · OH-1004

Cytoplasm0.126

Rank 3 · LXL04_037887 · OH-1004

Lysosome / Vacuole0.122

Rank 4 · LXL04_037887 · OH-1004

Cell membrane0.122

Rank 5 · LXL04_037887 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13439.13Glyco_transf_432-191 aa

PF13579.13Glyco_trans_4_432-191 aa

PF00534.27Glycos_transf_1318-433 aa

PF13692.13Glyco_trans_1_4321-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037887	`PF13439.13`	Glyco_transf_4	32	191	2.2e-06	28.5
LXL04_037887	`PF13579.13`	Glyco_trans_4_4	32	191	5.1e-06	27.6
LXL04_037887	`PF00534.27`	Glycos_transf_1	318	433	5.4e-11	43.0
LXL04_037887	`PF13692.13`	Glyco_trans_1_4	321	433	4.5e-10	40.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7M0`	Arabidopsis thaliana	UDP-glycosyltransferase TURAN	69.703%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card