LXL04_037771 | RubberDandelionOmics

Gene overview

LXL04_037771

Reference: OH-1004 Chr: Chr09 Coordinates: 20771425-20772690 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1266 bp · LXL04_037771|LXL04_037771|OH1004|cDNA

ATGGATTCAGTTAACCAATCCGCTCTCACCCCAAACAAAACCAAATTAGCTCGTAGTTTCGCCAAAGTTCTACACATTCGATCGACAAAAGTCAAACATGAGAAGCCAATCACAGACAACGGTCAAGCCAAATTCTTCAACGAAATTGAAGAACACGACAAGTTTCAGAGAGCAGTTATGGATGCGTTTATCGCGAAAGTTTTCGCGACGATTTTATCTGTTAAAGCTGCGTATGCACAGCTGCAATACGCTCAAACTCC...

CDS

Download CDS FASTA

1266 bp · LXL04_037771|LXL04_037771|OH1004|CDS

ATGGATTCAGTTAACCAATCCGCTCTCACCCCAAACAAAACCAAATTAGCTCGTAGTTTCGCCAAAGTTCTACACATTCGATCGACAAAAGTCAAACATGAGAAGCCAATCACAGACAACGGTCAAGCCAAATTCTTCAACGAAATTGAAGAACACGACAAGTTTCAGAGAGCAGTTATGGATGCGTTTATCGCGAAAGTTTTCGCGACGATTTTATCTGTTAAAGCTGCGTATGCACAGCTGCAATACGCTCAAACTCC...

Protein

Download Protein FASTA

421 aa · LXL04_037771|LXL04_037771|OH1004|PROTEIN

MDSVNQSALTPNKTKLARSFAKVLHIRSTKVKHEKPITDNGQAKFFNEIEEHDKFQRAVMDAFIAKVFATILSVKAAYAQLQYAQTPYDAEGIQSADQIVVSELKNLSELKQSFLKKHLDDSSPETTVMLAEIREQKNLLQMYEITGKKLDSQKKLKDSEIIFLKEKLNEVTRENKSIERRLNSSGPLSRDFSSLTPNDFHSALRQTTKSIRSFVKLMIEEMEVADWDIDAAAGAIQPDVVYSETTHKCYAFESFVCRVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037771`
TK1151 ID	TkA04G349150
OH-1004 ID	LXL04_037771
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 100.000 / OH-1004 85.986 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037771

Location Chr09:20771425-20772690 (-)

Description Similar to GIL1: Protein GRAVITROPIC IN THE LIGHT 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58960`	Required for red (R) and far red (FR) light-induced and phytochrome-mediated deregulation of negative gravitropism leading to randomization of hypocotyl growth orientation.	Phytochrome-mediated agravitropism in Arabidopsis hypocotyls requires GIL1 and confers a fitness advantage.2006 · DOI: 10.1111/j.1365-313x.2006.02727.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037771 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009639 response to red or far red light Biological Process

GO:0009959 negative gravitropism Biological Process

KEGG gene cross-reference

ath:AT5G58960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · LXL04_037771 · OH-1004

Nucleus0.373

Rank 2 · LXL04_037771 · OH-1004

Cell membrane0.188

Rank 3 · LXL04_037771 · OH-1004

Endoplasmic reticulum0.062

Rank 4 · LXL04_037771 · OH-1004

Lysosome / Vacuole0.048

Rank 5 · LXL04_037771 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04859.18DUF64157-181 aa

PF24994.2GIL1_IRKI_C372-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037771	`PF04859.18`	DUF641	57	181	1e-43	149.4
LXL04_037771	`PF24994.2`	GIL1_IRKI_C	372	419	5.5e-21	75.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KGE8`	Arabidopsis thaliana	Protein GRAVITROPIC IN THE LIGHT 1	32.170%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card