LXL04_037732 | RubberDandelionOmics

Gene overview

LXL04_037732

Reference: OH-1004 Chr: Chr09 Coordinates: 19671025-19673029 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1029 bp · LXL04_037732|LXL04_037732|OH1004|cDNA

ATGCCGGTGCCATCGTCTAGAAAGCTCTTCAATGCTCGCCATCCAGCTAACATTGGTCGTAGATCAATCGTGCTAGCAGCGATTGGTTTGTTATTCATCGGCATTATCGTTCTGAGACAAGATATTACAGGAGTATATAAATGTAAATACAGTAAACCTATATCGGTATCTGTGGTTTGGGACAGAAGTggtagtggtggtggtggttctaGCGATTTGGTTTCTGAAGGAGATCAGAAGAGGCACAAGGTGATGGCGTT...

CDS

Download CDS FASTA

1029 bp · LXL04_037732|LXL04_037732|OH1004|CDS

ATGCCGGTGCCATCGTCTAGAAAGCTCTTCAATGCTCGCCATCCAGCTAACATTGGTCGTAGATCAATCGTGCTAGCAGCGATTGGTTTGTTATTCATCGGCATTATCGTTCTGAGACAAGATATTACAGGAGTATATAAATGTAAATACAGTAAACCTATATCGGTATCTGTGGTTTGGGACAGAAGTGGTAGTGGTGGTGGTGGTTCTAGCGATTTGGTTTCTGAAGGAGATCAGAAGAGGCACAAGGTGATGGCGTT...

Protein

Download Protein FASTA

342 aa · LXL04_037732|LXL04_037732|OH1004|PROTEIN

MPVPSSRKLFNARHPANIGRRSIVLAAIGLLFIGIIVLRQDITGVYKCKYSKPISVSVVWDRSGSGGGGSSDLVSEGDQKRHKVMAFVGIQTGFASAGRRRSLRKTWMPSDHQGLQRLEEATGLAFRFVIGKTKDSSKMAQLRREVEEYDDFLLLDIEEEYSKLPYKTLAYFKAAFALYDSDFYVKADDDIYLRPDRLSLLLAKDRRHTQTYLGCMKKGPVFTDPKLKWHEPLGYMLGKEYFLHAYGPIYALSANVVASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037732`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037732

Location Chr09:19671025-19673029 (+)

Description Similar to B3GALT14: Probable beta-1,3-galactosyltransferase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53290`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At3g14960`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At2g26100`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g05170`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g32930`	Beta-galactosyltransferase involved in elongation of beta-1,6-linked galactan side chains on arabinogalactan proteins.	A galactosyltransferase acting on arabinogalactan protein glycans is essential for embryo development in Arabidopsis.2013 · DOI: 10.1111/tpj.12281 Galactosyltransferases from Arabidopsis thaliana in the biosynthesis of type II arabinogalactan: molecular interaction enhances enzyme activity.2014 · DOI: 10.1186/1471-2229-14-90

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037732 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05170

ath:AT1G32930

ath:AT1G53290

ath:AT2G26100

ath:AT3G14960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.853

Rank 1 · LXL04_037732 · OH-1004

Endoplasmic reticulum0.067

Rank 2 · LXL04_037732 · OH-1004

Cell membrane0.060

Rank 3 · LXL04_037732 · OH-1004

Extracellular0.050

Rank 4 · LXL04_037732 · OH-1004

Cytoplasm0.048

Rank 5 · LXL04_037732 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01762.28Galactosyl_T99-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037732	`PF01762.28`	Galactosyl_T	99	292	2.5e-48	165.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7M1`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 14	70.115%	Swiss-Prot	strong database homology
`Q9LKA9`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 13	68.678%	Swiss-Prot	strong database homology
`Q66GS2`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 12	61.043%	Swiss-Prot	strong database homology
`A8MRC7`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 2	36.264%	Swiss-Prot	moderate database homology
`Q9MAP8`	Arabidopsis thaliana	Beta-1,6-galactosyltransferase GALT31A	35.688%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card