LXL04_037731 | RubberDandelionOmics

Gene overview

LXL04_037731

Reference: OH-1004 Chr: Chr09 Coordinates: 19647491-19654051 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2532 bp · LXL04_037731|LXL04_037731|OH1004|cDNA

ATGAAGGGGCATTGCATCAAGTCGTTGAAGCTGTTGCTAAGCTGCAACATCGATAATCTACACGATGATTGTTTCGAAGGTTCAGTAGATGAAAGCCACATTTTCAGAGACGTGTTCTTCAACCATGAAGATACTAATCAAAACGACAATTGGAGTCCTAAATACATCTCATTCCGTTCAGACAGTGACAATTCAGTCATGACAAGTCAACTGGATTCCCTACAGTGTACCACATCTGAAGAGTTCGCTTCATTCACAAG...

CDS

Download CDS FASTA

2532 bp · LXL04_037731|LXL04_037731|OH1004|CDS

ATGAAGGGGCATTGCATCAAGTCGTTGAAGCTGTTGCTAAGCTGCAACATCGATAATCTACACGATGATTGTTTCGAAGGTTCAGTAGATGAAAGCCACATTTTCAGAGACGTGTTCTTCAACCATGAAGATACTAATCAAAACGACAATTGGAGTCCTAAATACATCTCATTCCGTTCAGACAGTGACAATTCAGTCATGACAAGTCAACTGGATTCCCTACAGTGTACCACATCTGAAGAGTTCGCTTCATTCACAAG...

Protein

Download Protein FASTA

843 aa · LXL04_037731|LXL04_037731|OH1004|PROTEIN

MKGHCIKSLKLLLSCNIDNLHDDCFEGSVDESHIFRDVFFNHEDTNQNDNWSPKYISFRSDSDNSVMTSQLDSLQCTTSEEFASFTRNDPDVEDSSFIELEKYELTLPPNNSTMDPKPILRYYTYTLLKSSGWLIGRRNRTTHCKGRGEYVFKSPEGRPIREFYRAWNMCGQTLVKDADYKTLRDDINWKDLTQFQSDLSFALTKVKEFVDSVIVTDLAHSWYLLDPFAKLVFIDKRLSLLKEGKEVKAKRSLVNGLYSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037731`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037731

Location Chr09:19647491-19654051 (+)

Description Similar to IDM1: Increased DNA methylation 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14980`	Histone H3 acetyltransferase that binds methylated DNA at chromatin sites lacking histone H3K4 di- or trimethylation and catalyzes H3K18 and H3K23 acetylation.	A histone acetyltransferase regulates active DNA demethylation in Arabidopsis.2012 · DOI: 10.1126/science.1219416 Antisilencing role of the RNA-directed DNA methylation pathway and a histone acetyltransferase in Arabidopsis.2012 · DOI: 10.1073/pnas.1208557109 Regulation of active DNA demethylation by an α-crystallin domain protein in Arabidopsis.2014 · DOI: 10.1016/j.molcel.2014.06.008

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006955 immune response Biological Process

GO:0006959 humoral immune response Biological Process

GO:0032722 positive regulation of chemokine production Biological Process

GO:0034728 nucleosome organization Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0000785 chromatin Cellular Component

KEGG gene cross-reference

ath:AT3G14980

dme:Dmel_CG9594

hsa:326

mmu:11634

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788

Rank 1 · LXL04_037731 · OH-1004

Cytoplasm0.220

Rank 2 · LXL04_037731 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_037731 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_037731 · OH-1004

Mitochondrion0.023

Rank 5 · LXL04_037731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16135.11TDBD347-397 aa

PF00628.36PHD424-463 aa

PF23209.2IDM1_C660-799 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037731	`PF16135.11`	TDBD	347	397	1.5e-11	44.8
LXL04_037731	`PF00628.36`	PHD	424	463	5e-07	30.4
LXL04_037731	`PF23209.2`	IDM1_C	660	799	5.1e-58	195.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IXE7`	Arabidopsis thaliana	Increased DNA methylation 1	41.331%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card