LXL04_037645 | RubberDandelionOmics

Gene overview

LXL04_037645

Reference: OH-1004 Chr: Chr09 Coordinates: 17011277-17012776 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1500 bp · LXL04_037645|LXL04_037645|OH1004|cDNA

ATGGGCAATACAGGTGAAGATGTAGATACACCTTCACCTATGAAgatagaaaagaaaaagaagaaaaacaaGAACATAACCAATGATGGTGATGGTGATGGTGATGGTGATGGTAACACTCATCTAAATGAGAAACTTCATGAACATacaaaaaagaagaagaagacatcAGAATCAAATGAAGATGTAGAAGAAAATGGTGATATTAAACAGAAGAAGAggaaaagagaaaaagaaaatgaTGATGATCCAAAAGTGAA...

CDS

Download CDS FASTA

1500 bp · LXL04_037645|LXL04_037645|OH1004|CDS

ATGGGCAATACAGGTGAAGATGTAGATACACCTTCACCTATGAAGATAGAAAAGAAAAAGAAGAAAAACAAGAACATAACCAATGATGGTGATGGTGATGGTGATGGTGATGGTAACACTCATCTAAATGAGAAACTTCATGAACATACAAAAAAGAAGAAGAAGACATCAGAATCAAATGAAGATGTAGAAGAAAATGGTGATATTAAACAGAAGAAGAGGAAAAGAGAAAAAGAAAATGATGATGATCCAAAAGTGAA...

Protein

Download Protein FASTA

499 aa · LXL04_037645|LXL04_037645|OH1004|PROTEIN

MGNTGEDVDTPSPMKIEKKKKKNKNITNDGDGDGDGDGNTHLNEKLHEHTKKKKKTSESNEDVEENGDIKQKKRKREKENDDDPKVNKDKKKKRELESNEDVDLQKKKKKKKKKYSSEKTQTKENEHSQEDDPKLVKHKKKKKKSKSNEDGGDDSNNLEDNGDLKKNAKKKKDSSENSQKKKTKKVTFSSDVEIFPPSKTKKKEKPKTDDNLVCGKRFTPEEDEIVKQAVEAYIVSNNLGDDGLKMILNCKSHKGMSKCW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037645`
TK1151 ID	TkAUNG027740
OH-1004 ID	LXL04_037645
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.000
Protein coverage (%)	TK1151 77.309 / OH-1004 77.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_037645`
Location	Chr09:17011277-17012776 (+)
Description	Similar to Dmtf1: Cyclin-D-binding Myb-like transcription factor 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037645` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000183 rDNA heterochromatin formation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006363 termination of RNA polymerase I transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0033553 rDNA heterochromatin Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function
KEGG gene cross-reference	dre:436938 hsa:9988 mmu:23857 rno:114485 sce:YDR026C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · LXL04_037645 · OH-1004

Cytoplasm0.078

Rank 2 · LXL04_037645 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_037645 · OH-1004

Mitochondrion0.010

Rank 4 · LXL04_037645 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_037645 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding290-330 aa

PF13921.13Myb_DNA-bind_6291-349 aa

PF00249.38Myb_DNA-binding339-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037645	`PF00249.38`	Myb_DNA-binding	290	330	1.7e-17	63.9
LXL04_037645	`PF13921.13`	Myb_DNA-bind_6	291	349	5.2e-15	56.1
LXL04_037645	`PF00249.38`	Myb_DNA-binding	339	403	1.7e-17	63.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card