LXL04_037552 | RubberDandelionOmics

Gene overview

LXL04_037552

Reference: OH-1004 Chr: Chr09 Coordinates: 14074537-14074884 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · LXL04_037552|LXL04_037552|OH1004|cDNA

ATGGCATCAAAGAACCAGGAGTTTCACGATTACTTACCTTTAATGGCGGATAAGTTAGGCGGGGAGGGTCTGATCGGGGAATTATGCAGCGGGTTTCAGCTCCTGGTGGACGCCGAAAAGGGGGTTATTACTTTTGAGAGTCTCAAGAACAATTCTTCGATTTTAGGGCTTCAGGATCTGAGCGATGATGATCTTCGGAGTATGTTGAGGGAAGGCGATTTTGATGGAGATGGAGCGCTTAATCAGATGGAATTTTGTGT...

CDS

Download CDS FASTA

348 bp · LXL04_037552|LXL04_037552|OH1004|CDS

ATGGCATCAAAGAACCAGGAGTTTCACGATTACTTACCTTTAATGGCGGATAAGTTAGGCGGGGAGGGTCTGATCGGGGAATTATGCAGCGGGTTTCAGCTCCTGGTGGACGCCGAAAAGGGGGTTATTACTTTTGAGAGTCTCAAGAACAATTCTTCGATTTTAGGGCTTCAGGATCTGAGCGATGATGATCTTCGGAGTATGTTGAGGGAAGGCGATTTTGATGGAGATGGAGCGCTTAATCAGATGGAATTTTGTGT...

Protein

Download Protein FASTA

115 aa · LXL04_037552|LXL04_037552|OH1004|PROTEIN

MASKNQEFHDYLPLMADKLGGEGLIGELCSGFQLLVDAEKGVITFESLKNNSSILGLQDLSDDDLRSMLREGDFDGDGALNQMEFCVLMFRLSPDLMEQSEFLLEEALEHEFDQM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037552`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037552

Location Chr09:14074537-14074884 (-)

Description Similar to KRP1: Calcium-binding protein KRP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27280`	Potential calcium sensor that binds calcium in vitro.	No verified direct reference in this release
`At5g54490`	Potential calcium sensor that binds calcium in vitro.	No verified direct reference in this release
`At2g46600`	Calcium-binding regulatory protein that interacts with kinesin motor protein KCBP in a calcium-dependent manner.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0007099 centriole replication Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009733 response to auxin Biological Process

GO:0010091 trichome branching Biological Process

GO:0015031 protein transport Biological Process

GO:0032465 regulation of cytokinesis Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051301 cell division Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G46600

ath:AT4G27280

ath:AT5G54490

bta:508601

mmu:26370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · LXL04_037552 · OH-1004

Nucleus0.310

Rank 2 · LXL04_037552 · OH-1004

Mitochondrion0.110

Rank 3 · LXL04_037552 · OH-1004

Cell membrane0.098

Rank 4 · LXL04_037552 · OH-1004

Golgi apparatus0.094

Rank 5 · LXL04_037552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13833.13EF-hand_839-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037552	`PF13833.13`	EF-hand_8	39	91	3.6e-21	75.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81831`	Arabidopsis thaliana	Calcium-binding protein KRP1	68.468%	Swiss-Prot	strong database homology
`Q9LSQ6`	Arabidopsis thaliana	Calcium-binding protein PBP1	66.964%	Swiss-Prot	strong database homology
`Q9ZPX9`	Arabidopsis thaliana	Calcium-binding protein KIC	55.660%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card