LXL04_037507 | RubberDandelionOmics

Gene overview

LXL04_037507

Reference: OH-1004 Chr: Chr09 Coordinates: 12440984-12442709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_037507|LXL04_037507|OH1004|cDNA

ATGGATGAGTTTTTCAATAAGCTAAAGCGACCTTTCAACGGTACTTGGGATGCTGTGGAGTCTGACATGTCAGTGTTCGAGTACATAATGATTAGGCTTCCCGTCAAAAGCATATTAATGTTCAAATCCATCTCAAAACACTGGTACAATGTAATATCCACAAAGATTTTCATGCAATTACATTATCATTGGTCAAAAAAGAATGCCAAATTCTTCGCCTTCCATGATCCCATTGACAAAGAAAACAATGAATATTGTGA...

CDS

Download CDS FASTA

1176 bp · LXL04_037507|LXL04_037507|OH1004|CDS

ATGGATGAGTTTTTCAATAAGCTAAAGCGACCTTTCAACGGTACTTGGGATGCTGTGGAGTCTGACATGTCAGTGTTCGAGTACATAATGATTAGGCTTCCCGTCAAAAGCATATTAATGTTCAAATCCATCTCAAAACACTGGTACAATGTAATATCCACAAAGATTTTCATGCAATTACATTATCATTGGTCAAAAAAGAATGCCAAATTCTTCGCCTTCCATGATCCCATTGACAAAGAAAACAATGAATATTGTGA...

Protein

Download Protein FASTA

391 aa · LXL04_037507|LXL04_037507|OH1004|PROTEIN

MDEFFNKLKRPFNGTWDAVESDMSVFEYIMIRLPVKSILMFKSISKHWYNVISTKIFMQLHYHWSKKNAKFFAFHDPIDKENNEYCEMHLMEPNGVYIESYPINPVFKTLEDINLIASFNGLICLMNDATLHEMAYNMDLRICNPATHEVLLLPRSHMSQDKPIFGVLYSNKSHIYKIFKFFSDDPKIGYSRCEVYFSKTRQWKLATGVPTHTLMQPTRSWLSNSNGVCVNEKLYWFSADGYEDGIDYSASVLMVDMEEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037507`
TK1151 ID	TkA04G314580
OH-1004 ID	LXL04_037507
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037507

Location Chr09:12440984-12442709 (+)

Description Similar to FBX15: Putative F-box only protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02030`	Putative F-box protein At2g02030.	No verified direct reference in this release
`At4g04690`	Putative F-box only protein 15.	No verified direct reference in this release
`At5g10340`	F-box protein At5g10340.	No verified direct reference in this release
`At3g23960`	Putative F-box protein At3g23960.	No verified direct reference in this release
`At3g17280`	Putative F-box/kelch-repeat protein At3g17280.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037507 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G02030

ath:AT3G17280

ath:AT3G23960

ath:AT4G04690

ath:AT5G10340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · LXL04_037507 · OH-1004

Nucleus0.380

Rank 2 · LXL04_037507 · OH-1004

Cell membrane0.159

Rank 3 · LXL04_037507 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_037507 · OH-1004

Lysosome / Vacuole0.055

Rank 5 · LXL04_037507 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268.18FBA_3111-365 aa

PF07734.19FBA_1111-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037507	`PF08268.18`	FBA_3	111	365	7.6e-14	52.2
LXL04_037507	`PF07734.19`	FBA_1	111	269	7.1e-12	45.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPS1`	Arabidopsis thaliana	Putative F-box protein At2g02030	25.987%	Swiss-Prot	weak database homology
`Q9S9V1`	Arabidopsis thaliana	Putative F-box only protein 15	25.114%	Swiss-Prot	weak database homology
`Q9LX89`	Arabidopsis thaliana	F-box protein At5g10340	23.120%	Swiss-Prot	weak database homology
`Q9LIR1`	Arabidopsis thaliana	Putative F-box protein At3g23960	25.991%	Swiss-Prot	weak database homology
`Q9LUU3`	Arabidopsis thaliana	Putative F-box/kelch-repeat protein At3g17280	26.339%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card