LXL04_037496 | RubberDandelionOmics

Gene overview

LXL04_037496

Reference: OH-1004 Chr: Chr09 Coordinates: 12207955-12211378 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1353 bp · LXL04_037496|LXL04_037496|OH1004|cDNA

ATGATGAACATTTTGCGAAAAGACCCGGGGTTACCGACTGATTCGTTTTATGAGGTTCGAGCTGGCTTTTCCGATGGCCCTAAAACCAATTTTAGAATCAAGGCCGGAAAGACACTTAGTGAAAAAAGATGGCGGGCTTCATTTTCAGATGAAGGTTGTATTGATATAAGCAAGTGCCTTGGTAGAATCTATCGTGGAGGAGTTCATCCATCAATTAGAGGAGAAGTGTGGGAAATTCTACTCGGTTGTTATGATCATAA...

CDS

Download CDS FASTA

1353 bp · LXL04_037496|LXL04_037496|OH1004|CDS

ATGATGAACATTTTGCGAAAAGACCCGGGGTTACCGACTGATTCGTTTTATGAGGTTCGAGCTGGCTTTTCCGATGGCCCTAAAACCAATTTTAGAATCAAGGCCGGAAAGACACTTAGTGAAAAAAGATGGCGGGCTTCATTTTCAGATGAAGGTTGTATTGATATAAGCAAGTGCCTTGGTAGAATCTATCGTGGAGGAGTTCATCCATCAATTAGAGGAGAAGTGTGGGAAATTCTACTCGGTTGTTATGATCATAA...

Protein

Download Protein FASTA

450 aa · LXL04_037496|LXL04_037496|OH1004|PROTEIN

MMNILRKDPGLPTDSFYEVRAGFSDGPKTNFRIKAGKTLSEKRWRASFSDEGCIDISKCLGRIYRGGVHPSIRGEVWEILLGCYDHKSTFQEREQIRQRRREQYAELKESCKKMFPIVGSGKFITARVITANGDLIHNPMEVLGTSPEKPSTTQSQETVVREHDKDIIQWKLALHQIGLDVVRTDRTLMFYEKQENLAKLWDILAVYAWFDKDVGYGQGMSDLCSPMIMLLEDEADAFWCFERLMRRLRGNFRCTGNTVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037496`
TK1151 ID	TkA04G313900
OH-1004 ID	LXL04_037496
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.105 / OH-1004 98.444 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_037496`
Location	Chr09:12207955-12211378 (+)
Description	Similar to Tbc1d15: TBC1 domain family member 15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037496` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0016192 vesicle-mediated transport Biological Process GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process GO:0043087 regulation of GTPase activity Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005770 late endosome Cellular Component GO:0005829 cytosol Cellular Component GO:0005096 GTPase activator activity Molecular Function
KEGG gene cross-reference	cgr:2886868 hsa:64786 mmu:66687 spo:2543609 yli:2907695 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.603

Rank 1 · LXL04_037496 · OH-1004

Nucleus0.301

Rank 2 · LXL04_037496 · OH-1004

Cell membrane0.170

Rank 3 · LXL04_037496 · OH-1004

Golgi apparatus0.091

Rank 4 · LXL04_037496 · OH-1004

Lysosome / Vacuole0.076

Rank 5 · LXL04_037496 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00566.26RabGAP-TBC149-323 aa

PF23436.2RabGap-TBC_2199-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037496	`PF00566.26`	RabGAP-TBC	149	323	1.1e-37	130.5
LXL04_037496	`PF23436.2`	RabGap-TBC_2	199	318	2.7e-10	41.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card