LXL04_037487 | RubberDandelionOmics

Gene overview

LXL04_037487

Reference: OH-1004 Chr: Chr09 Coordinates: 12042751-12044660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_037487|LXL04_037487|OH1004|cDNA

ATGGCTTACCACCTCTCTACTATCGCCACCGAAAAATCACCGGTATTGCTCTTACAATCGCATTCTCCCTCAATCGCCGCCAGGAAATTACCAACAAATACAAGCTTCAAATGTTGTATCAAGTCATCATTAAAAGTATCAACCAAAGATGCTTCTAGACATCTCGTATCAGCACTTGCTGCTTCCTTGCTACTTCTATCTCCAACAAATCAGGTTTTGGCGACAGAACTTTCACATAATAATTTATGTCAGATTTCAAG...

CDS

Download CDS FASTA

1002 bp · LXL04_037487|LXL04_037487|OH1004|CDS

ATGGCTTACCACCTCTCTACTATCGCCACCGAAAAATCACCGGTATTGCTCTTACAATCGCATTCTCCCTCAATCGCCGCCAGGAAATTACCAACAAATACAAGCTTCAAATGTTGTATCAAGTCATCATTAAAAGTATCAACCAAAGATGCTTCTAGACATCTCGTATCAGCACTTGCTGCTTCCTTGCTACTTCTATCTCCAACAAATCAGGTTTTGGCGACAGAACTTTCACATAATAATTTATGTCAGATTTCAAG...

Protein

Download Protein FASTA

333 aa · LXL04_037487|LXL04_037487|OH1004|PROTEIN

MAYHLSTIATEKSPVLLLQSHSPSIAARKLPTNTSFKCCIKSSLKVSTKDASRHLVSALAASLLLLSPTNQVLATELSHNNLCQISSTSDKLPTLPVDDSSNLMMMRGMTARNFDPVRYSGRWYEVASLKRGFAGQGQEDCHCTQGVYTIDMAKKAIQVDTFCVHGGPDGYITGIRGRVQCLSDEESEKTQSDLERQEMIKEKCYLRFPTLPFIPKLPYDVIDTDYDNFALVSGAKDQGFIQIYSRTPNPGEKFIEKYKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037487`
TK1151 ID	TkA04G312870
OH-1004 ID	LXL04_037487
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037487

Location Chr09:12042751-12044660 (-)

Description Similar to CHL: Chloroplastic lipocalin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47860`	Lipocalin that prevents thylakoidal membrane lipids peroxidation and confers protection against oxidative stress, especially mediated by singlet oxygen in response to high light and other stress (e.g. heat shocks).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037487 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010117 photoprotection Biological Process

GO:0010431 seed maturation Biological Process

GO:0010642 negative regulation of platelet-derived growth factor receptor signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G47860

cpoc:100735684

hsa:347

mmu:11815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · LXL04_037487 · OH-1004

Mitochondrion0.031

Rank 2 · LXL04_037487 · OH-1004

Cytoplasm0.017

Rank 3 · LXL04_037487 · OH-1004

Nucleus0.016

Rank 4 · LXL04_037487 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_037487 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08212.19Lipocalin_2117-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037487	`PF08212.19`	Lipocalin_2	117	277	2.2e-10	41.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STS7`	Arabidopsis thaliana	Chloroplastic lipocalin	66.562%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card