Gene Card
Gene overview
cDNA / CDS / Protein Sequences
432 bp · LXL04_037452|LXL04_037452|OH1004|cDNA
ATGACCAACGTCGATGAACGCCAAATCGGAGAAGTCTTCCGTCCCTCCCCTCGTACTCGTCCGCACGATCGTCCAGGTGGCGGGTCGAATGCCATGGGTCTGTTCCATGAGTTTGTGGAAGATACGGAGGTGAGGATGATCGGAGTGGAGGCGGCGGGGTTTGGGATCGAGAGCGGGAAACATGCTGCCACTTTGACGAAAGGGGAGGTCGGGGTGTTGCATGGGGCTATGAGTTATTTGTTGCAGGATGATGATGGCCA...
432 bp · LXL04_037452|LXL04_037452|OH1004|CDS
ATGACCAACGTCGATGAACGCCAAATCGGAGAAGTCTTCCGTCCCTCCCCTCGTACTCGTCCGCACGATCGTCCAGGTGGCGGGTCGAATGCCATGGGTCTGTTCCATGAGTTTGTGGAAGATACGGAGGTGAGGATGATCGGAGTGGAGGCGGCGGGGTTTGGGATCGAGAGCGGGAAACATGCTGCCACTTTGACGAAAGGGGAGGTCGGGGTGTTGCATGGGGCTATGAGTTATTTGTTGCAGGATGATGATGGCCA...
Protein
Download Protein FASTA143 aa · LXL04_037452|LXL04_037452|OH1004|PROTEIN
MTNVDERQIGEVFRPSPRTRPHDRPGGGSNAMGLFHEFVEDTEVRMIGVEAAGFGIESGKHAATLTKGEVGVLHGAMSYLLQDDDGQIIEPHSISAGLDYPGVGPEHSFLKDLGRAEYYSITDEEAPEGKKHFRPCGFSKRTD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037452 |
|---|---|
| TK1151 ID | TkA04G309560 |
| OH-1004 ID | LXL04_037452 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037452 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr09:11395479-11396404 (-) | |||||||||
| Description | Similar to TSB1: Tryptophan synthase beta chain 1, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000162 L-tryptophan biosynthetic process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009684 indoleacetic acid biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0004834 tryptophan synthase activity Molecular Function GO:0019904 protein domain specific binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT4G27070 ath:AT5G54810 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.