LXL04_037268 | RubberDandelionOmics

Gene overview

LXL04_037268

Reference: OH-1004 Chr: Chr09 Coordinates: 4732126-4732680 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_037268|LXL04_037268|OH1004|cDNA

ATGGCAACAACCGCTCATCAGTTAACATGCTCATGTTCACCAAAACTCAACGAAAACTCCCcccaaaaaacaaaattacagtCACAATGTCAACACACCCACACCCACACCCACATCACAAGACGAAAGCTCTTCCTCCTTATTTCTTCCCCAATTCCAATCCTTTCGCAACCTGTACACGCAGCCGAATCCCCCAATTCCTTTCTCGACATGTTCCGAATGACGGTTCCTGACCAGACCGTAGAAGAAGCGGAGAGCGG...

CDS

Download CDS FASTA

555 bp · LXL04_037268|LXL04_037268|OH1004|CDS

ATGGCAACAACCGCTCATCAGTTAACATGCTCATGTTCACCAAAACTCAACGAAAACTCCCCCCAAAAAACAAAATTACAGTCACAATGTCAACACACCCACACCCACACCCACATCACAAGACGAAAGCTCTTCCTCCTTATTTCTTCCCCAATTCCAATCCTTTCGCAACCTGTACACGCAGCCGAATCCCCCAATTCCTTTCTCGACATGTTCCGAATGACGGTTCCTGACCAGACCGTAGAAGAAGCGGAGAGCGG...

Protein

Download Protein FASTA

184 aa · LXL04_037268|LXL04_037268|OH1004|PROTEIN

MATTAHQLTCSCSPKLNENSPQKTKLQSQCQHTHTHTHITRRKLFLLISSPIPILSQPVHAAESPNSFLDMFRMTVPDQTVEEAESGIREHAMSLVQVKPLLESESWKDAQKELRKSSSFLKQDIYTIIQGKPGPERAPLRVLYSKLFNDVTGLDYAARDKDVPRVWKLYQDIVVTLDDILSKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037268`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037268

Location Chr09:4732126-4732680 (-)

Description Similar to PQL3: PsbQ-like protein 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01918`	Required for both formation and activity of the chloroplast NAD(P)H dehydrogenase (NDH) complex.	Three PsbQ-like proteins are required for the function of the chloroplast NAD(P)H dehydrogenase complex in Arabidopsis.2010 · DOI: 10.1093/pcp/pcq060
`At4g21280`	May participate in photosystem II assembly and stabilization.	The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions.2006 · DOI: 10.1074/jbc.m603582200
`At4g05180`	May participate in photosystem II assembly and stabilization.	The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions.2006 · DOI: 10.1074/jbc.m603582200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037268 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

KEGG gene cross-reference

ath:AT2G01918

ath:AT4G05180

ath:AT4G21280

zma:542279

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.985

Rank 1 · LXL04_037268 · OH-1004

Mitochondrion0.022

Rank 2 · LXL04_037268 · OH-1004

Nucleus0.013

Rank 3 · LXL04_037268 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_037268 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_037268 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05757.17PsbQ1-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037268	`PF05757.17`	PsbQ	1	183	6.9e-24	85.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2V4B2`	Arabidopsis thaliana	PsbQ-like protein 3, chloroplastic	41.333%	Swiss-Prot	moderate database homology
`Q9XFT3`	Arabidopsis thaliana	Oxygen-evolving enhancer protein 3-1, chloroplastic	37.255%	Swiss-Prot	moderate database homology
`Q41932`	Arabidopsis thaliana	Oxygen-evolving enhancer protein 3-2, chloroplastic	35.294%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card