LXL04_037170 | RubberDandelionOmics

Gene overview

LXL04_037170

Reference: OH-1004 Chr: Chr09 Coordinates: 793116-799870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · LXL04_037170|LXL04_037170|OH1004|cDNA

ATGGCCTTTATTTCCAAGGTTCACAACTTCTCCGGCGACTTTCAAACTCCGACAACCACCCCACAAATGTGGTTTGATCATGAGACTACTTCACCCGGTTTTTTTGACAACTATGGGATGATGACAATGCCACCGGAATATGACATCATCACCACACCTTTATCTCGATCATCTTCATGGAAGACTTCATTCCCGGAGAGATTTGGGGTTTATGATGTGATGGTGGTTCCAACATCGCCTAGTACCGGATATAGTGGTAT...

CDS

Download CDS FASTA

849 bp · LXL04_037170|LXL04_037170|OH1004|CDS

ATGGCCTTTATTTCCAAGGTTCACAACTTCTCCGGCGACTTTCAAACTCCGACAACCACCCCACAAATGTGGTTTGATCATGAGACTACTTCACCCGGTTTTTTTGACAACTATGGGATGATGACAATGCCACCGGAATATGACATCATCACCACACCTTTATCTCGATCATCTTCATGGAAGACTTCATTCCCGGAGAGATTTGGGGTTTATGATGTGATGGTGGTTCCAACATCGCCTAGTACCGGATATAGTGGTAT...

Protein

Download Protein FASTA

282 aa · LXL04_037170|LXL04_037170|OH1004|PROTEIN

MAFISKVHNFSGDFQTPTTTPQMWFDHETTSPGFFDNYGMMTMPPEYDIITTPLSRSSSWKTSFPERFGVYDVMVVPTSPSTGYSGIPPGTDYQKVEKDDFFCSNGTNSWLSAYPGANTNWEIENQKSSSEIEEPTLKIGRYSVEERKDKIMKYLKKRNQRNFNKTIKYECRKTLADKRIRVRGRFAKNKNDHPHHHLHDHNQPCEDQVLPNINNSNPCEQDIQQQYTNNFMMKQDYDEEEEWLHEAMASLPVRSIHVVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037170`
TK1151 ID	TkA04G254480
OH-1004 ID	LXL04_037170
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.209 / OH-1004 89.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037170

Location Chr09:793116-799870 (+)

Description Similar to COL4: Zinc finger protein CONSTANS-LIKE 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24930`	Zinc finger protein CONSTANS-LIKE 4.	No verified direct reference in this release
`At1g28050`	Zinc finger protein CONSTANS-LIKE 15.	No verified direct reference in this release
`At5g15850`	Putative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0275000`	Probable transcription factor involved in the regulation of flower development.	No verified direct reference in this release
`Os07g0261200`	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions.	Natural variation in Ghd7 is an important regulator of heading date and yield potential in rice.2008 · DOI: 10.1038/ng.143 Hd16, a gene for casein kinase I, is involved in the control of rice flowering time by modulating the day-length response.2013 · DOI: 10.1111/tpj.12268

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048571 long-day photoperiodism Biological Process

GO:0048572 short-day photoperiodism Biological Process

GO:0048576 positive regulation of short-day photoperiodism, flowering Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G28050

ath:AT5G15850

ath:AT5G24930

dosa:Os06g0275000

osa:107276161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.919

Rank 1 · LXL04_037170 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_037170 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_037170 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_037170 · OH-1004

Plastid0.013

Rank 5 · LXL04_037170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203.20CCT147-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037170	`PF06203.20`	CCT	147	189	2.9e-17	63.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940T9`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 4	40.351%	Swiss-Prot	weak database homology
`Q9C7E8`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 15	51.111%	Swiss-Prot	weak database homology
`O50055`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 1	44.898%	Swiss-Prot	weak database homology
`Q9FDX8`	Oryza sativa subsp. japonica	Zinc finger protein HD1	39.655%	Swiss-Prot	weak database homology
`E5RQA1`	Oryza sativa subsp. japonica	Transcription factor GHD7	46.939%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card