LXL04_037017 | RubberDandelionOmics

Gene overview

LXL04_037017

Reference: OH-1004 Chr: Chr08 Coordinates: 51772485-51773149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_037017|LXL04_037017|OH1004|cDNA

CAATCAGAGCCTACTTTTCCATTTCGCCTACAGAATCTCCACTATAAAGAAACCAGTTTCCCTCTTTGGATTCAATTATCATCCCTCCcatttacaaattacaaatcaaCAAACCCTCGAAACCGCCATTCTAATTTCTACAAAGCAATGGAATCACCAAAAGCGAATAAATCCGCCGCAGGAAGAGGCAAATCCACATCCACGAAGTCCGTCTCCCGATCTTCGAAAGCCGGTCTCCAGTTCCCCGTCGGCAGAATCTC...

CDS

Download CDS FASTA

426 bp · LXL04_037017|LXL04_037017|OH1004|CDS

ATGGAATCACCAAAAGCGAATAAATCCGCCGCAGGAAGAGGCAAATCCACATCCACGAAGTCCGTCTCCCGATCTTCGAAAGCCGGTCTCCAGTTCCCCGTCGGCAGAATCTCCCGGTACTTGAAAAACGGCCGATATGCCAAACGCGTCGGCTCCGGCAGCCCTGTTTACCTCTCCGCCGTCCTTGAATACCTGGCAGCCGAGGTTTTGGAGCTAGCTGGGAATGCTGCGAGGGATAACAAGAAGACTCGGATCATACC...

Protein

Download Protein FASTA

141 aa · LXL04_037017|LXL04_037017|OH1004|PROTEIN

MESPKANKSAAGRGKSTSTKSVSRSSKAGLQFPVGRISRYLKNGRYAKRVGSGSPVYLSAVLEYLAAEVLELAGNAARDNKKTRIIPRHIQLAVRNDEELSKLLGRVTIANGGVLPNIHQTLLPNKKTKGKDVIGSVSQEF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037017`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037017

Location Chr08:51772485-51773149 (+)

Description Similar to At1g08880: Probable histone H2AXa

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08880`	Variant histone H2A which replaces conventional H2A in a subset of nucleosomes.	No verified direct reference in this release
`At1g54690`	Variant histone H2A which replaces conventional H2A in a subset of nucleosomes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0530000`	Variant histone H2A which replaces conventional H2A in a subset of nucleosomes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037017 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G08880

ath:AT1G54690

cam:101514555

dosa:Os12g0530000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_037017 · OH-1004

Cytoplasm0.087

Rank 2 · LXL04_037017 · OH-1004

Cell membrane0.012

Rank 3 · LXL04_037017 · OH-1004

Extracellular0.010

Rank 4 · LXL04_037017 · OH-1004

Mitochondrion0.007

Rank 5 · LXL04_037017 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone17-95 aa

PF16211.11Histone_H2A_C98-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037017	`PF00125.31`	Histone	17	95	5.7e-14	53.0
LXL04_037017	`PF16211.11`	Histone_H2A_C	98	131	1.1e-18	67.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04848`	Arabidopsis thaliana	Probable histone H2AXa	85.385%	Swiss-Prot	strong database homology
`Q9S9K7`	Arabidopsis thaliana	Probable histone H2AXb	85.385%	Swiss-Prot	strong database homology
`Q2QPG9`	Oryza sativa subsp. japonica	Probable histone H2AXb	85.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card