Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1470 bp · LXL04_037014|LXL04_037014|OH1004|cDNA
ATGTACTTTAGGGCTTGGAATACTGCCATAGGTGACATGGGATATGCTCTGAGTAGATTAGAGATAGACCCAAACTTTTCAGACAGCGAATCATCTCCTGTTGGAGAAGATAATGACAGCCCTCAACCTTCATCAGACAACAATTTGGATCATGAAGTTGCTCAACTTACAAAGCTGCAATCAACACCTCATAAAAGGCTGAAACAAGTTCTTCCAAGAAGGCAGGAGTTTCCAGTTTCTCCAGTTAAGATGTTAGCTGG...
1470 bp · LXL04_037014|LXL04_037014|OH1004|CDS
ATGTACTTTAGGGCTTGGAATACTGCCATAGGTGACATGGGATATGCTCTGAGTAGATTAGAGATAGACCCAAACTTTTCAGACAGCGAATCATCTCCTGTTGGAGAAGATAATGACAGCCCTCAACCTTCATCAGACAACAATTTGGATCATGAAGTTGCTCAACTTACAAAGCTGCAATCAACACCTCATAAAAGGCTGAAACAAGTTCTTCCAAGAAGGCAGGAGTTTCCAGTTTCTCCAGTTAAGATGTTAGCTGG...
Protein
Download Protein FASTA489 aa · LXL04_037014|LXL04_037014|OH1004|PROTEIN
MYFRAWNTAIGDMGYALSRLEIDPNFSDSESSPVGEDNDSPQPSSDNNLDHEVAQLTKLQSTPHKRLKQVLPRRQEFPVSPVKMLAGREGNYSGRGRFTSADRCHLLNKYLPVKGPSIVDQLTTRAYVSQFSDDGSLFVAAFQGSHIKIYNAEKGWTLQKNIVAKSLRWTITDTSLSPDKRFLVYATMSPIVNIVNIGSAATESHANITEIHEALEFSGDDEGGYSFGIFSVKFSNDGRELVAGSSDDSIYVYDVEANKL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037014 |
|---|---|
| TK1151 ID | TkA04G010910 |
| OH-1004 ID | LXL04_037014 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 61.759Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037014 |
|---|---|
| Location | Chr08:51667512-51670582 (-) |
| Description | Similar to LEC14B protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0003016 respiratory system process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0007005 mitochondrion organization Biological Process GO:0010467 gene expression Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0050821 protein stabilization Biological Process GO:0080135 regulation of cellular response to stress Biological Process GO:1902412 regulation of mitotic cytokinesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component |
| KEGG gene cross-reference | bta:539433 hsa:80344 mmu:28199 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23393.3Beta-prop_WDR90_POC16_2nd132-343 aaPF24805.2EIF3I137-299 aaPF23098.2Beta-prop_NOL10_N137-299 aaPF25173.2Beta-prop_WDR3_1st146-297 aaPF24796.2WDR55171-348 aaPF25171.2Beta-prop_WDR36-Utp21_1st175-296 aaPF24782.3WD40_MABP1-WDR62_2nd216-297 aaPF25172.2Beta-prop_WDR3_2nd224-343 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037014 | PF23393.3 | Beta-prop_WDR90_POC16_2nd | 132 | 343 | 1.1e-07 | 32.2 |
| LXL04_037014 | PF24805.2 | EIF3I | 137 | 299 | 2.5e-16 | 60.4 |
| LXL04_037014 | PF23098.2 | Beta-prop_NOL10_N | 137 | 299 | 1e-09 | 38.8 |
| LXL04_037014 | PF25173.2 | Beta-prop_WDR3_1st | 146 | 297 | 5.5e-33 | 114.9 |
| LXL04_037014 | PF24796.2 | WDR55 | 171 | 348 | 9.4e-23 | 81.4 |
| LXL04_037014 | PF25171.2 | Beta-prop_WDR36-Utp21_1st | 175 | 296 | 7.4e-15 | 55.8 |
| LXL04_037014 | PF24782.3 | WD40_MABP1-WDR62_2nd | 216 | 297 | 8.2e-15 | 55.3 |
| LXL04_037014 | PF25172.2 | Beta-prop_WDR3_2nd | 224 | 343 | 1.7e-20 | 74.2 |
| LXL04_037014 | PF25391.2 | WD40_Gbeta | 224 | 300 | 4.5e-16 | 59.5 |
| LXL04_037014 | PF00400.39 | WD40 | 226 | 254 | 8.7e-34 | 115.2 |
| LXL04_037014 | PF25175.2 | Beta-prop_WDR5 | 228 | 347 | 2.7e-38 | 132.7 |
| LXL04_037014 | PF24814.2 | WD40_Prp19 | 228 | 347 | 6.8e-29 | 101.5 |
| LXL04_037014 | PF24807.2 | WD40_CDC20-Fz | 228 | 350 | 1.2e-25 | 91.2 |
| LXL04_037014 | PF24105.2 | Beta-prop_CAF1B_HIR1 | 228 | 299 | 1.1e-11 | 45.1 |
| LXL04_037014 | PF25174.2 | Beta-prop_THOC3 | 229 | 463 | 1.1e-32 | 113.9 |
| LXL04_037014 | PF23381.2 | Beta-prop_IFT122_1st | 229 | 299 | 7.6e-31 | 108.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.