LXL04_037010 | RubberDandelionOmics

Gene overview

LXL04_037010

Reference: OH-1004 Chr: Chr08 Coordinates: 51617051-51631862 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7386 bp · LXL04_037010|LXL04_037010|OH1004|cDNA

ATGAACGATCTGGCTTCGACCTTAGGAGCCAACAATGGGGGTATTAGTCGGTGGATATCTGTTGTCATTGCTACTATTTACAGCTGCTTTACTAAATTGGAGTTTGATATCTCTTGGGAACTTGCTAGCTTCTTTACTTATTCTATTCGTTCATCTGGAAAAAGGATTTCACTCAAAGGGGAGAATAGTACTATGGGGTATTATTGTATACTCCCTTGTTGTTATCCTTTCACAGTTGACTTTTCAATTAGCATGGGCCA...

CDS

Download CDS FASTA

7386 bp · LXL04_037010|LXL04_037010|OH1004|CDS

ATGAACGATCTGGCTTCGACCTTAGGAGCCAACAATGGGGGTATTAGTCGGTGGATATCTGTTGTCATTGCTACTATTTACAGCTGCTTTACTAAATTGGAGTTTGATATCTCTTGGGAACTTGCTAGCTTCTTTACTTATTCTATTCGTTCATCTGGAAAAAGGATTTCACTCAAAGGGGAGAATAGTACTATGGGGTATTATTGTATACTCCCTTGTTGTTATCCTTTCACAGTTGACTTTTCAATTAGCATGGGCCA...

Protein

Download Protein FASTA

2461 aa · LXL04_037010|LXL04_037010|OH1004|PROTEIN

MNDLASTLGANNGGISRWISVVIATIYSCFTKLEFDISWELASFFTYSIRSSGKRISLKGENSTMGYYCILPCCYPFTVDFSISMGHLVWKLRLKKERSPKIIYYLILQLLAAFTATTELHEIRLGFFTWSSSFFGDLAEAIERIGSHVKVAFFLLLPSVQLVAGISNTSWISLPFFVSSCVGLVDWSLSSNFHGVFRLWRALWLYAGFNITFLYIYQLPTKSLDKIGDVIGLYRISSASDWAEICSGFSLIIFFFGLSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037010`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037010

Location Chr08:51617051-51631862 (+)

Description Similar to At2g48060/At2g48040/At2g48050: Piezo-type mechanosensitive ion channel homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: F4IN58`	Pore-forming subunit of a mechanosensitive non-specific cation channel, that conducts both sodium and potassium ions.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037010 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0042391 regulation of membrane potential Biological Process

GO:0050982 detection of mechanical stimulus Biological Process

GO:0071260 cellular response to mechanical stimulus Biological Process

GO:0098655 monoatomic cation transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005261 monoatomic cation channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G48060

ddi:DDB_G0282801

dme:Dmel_CG44122

hsa:63895

mmu:667742

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.354

Rank 1 · LXL04_037010 · OH-1004

Cell membrane0.248

Rank 2 · LXL04_037010 · OH-1004

Golgi apparatus0.217

Rank 3 · LXL04_037010 · OH-1004

Cytoplasm0.187

Rank 4 · LXL04_037010 · OH-1004

Lysosome / Vacuole0.137

Rank 5 · LXL04_037010 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25288.2PIEZO464-593 aa

PF23188.2THU_Piezo11603-1675 aa

PF24874.2Piezo_THU9_anchor1916-2153 aa

PF12166.15Piezo_cap2199-2457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037010	`PF25288.2`	PIEZO	464	593	4.8e-55	186.0
LXL04_037010	`PF23188.2`	THU_Piezo1	1603	1675	1.9e-12	48.0
LXL04_037010	`PF24874.2`	Piezo_THU9_anchor	1916	2153	3.6e-65	220.4
LXL04_037010	`PF12166.15`	Piezo_cap	2199	2457	1.2e-71	242.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IN58`	Arabidopsis thaliana	Piezo-type mechanosensitive ion channel homolog	62.313%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card