LXL04_037002 | RubberDandelionOmics

Gene overview

LXL04_037002

Reference: OH-1004 Chr: Chr08 Coordinates: 51538212-51542342 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · LXL04_037002|LXL04_037002|OH1004|cDNA

ATGGGAAGAGCGTCGATAGAAACATCGAGGACATCTTCGTCGTCGTCGCCAGCGGCGGTTTCAACCACGTCTACATCGGTCACCGAGACGGTGAACGGAGAACATGATTTTAGGATTTCGGGTTACTCGTTATCGAAAGGAATTGGAATTGGGAAGTATATAGCGTCTGATACGTTTATGGTTGGTGGGTATTCATGGGCTATATATTTTTATCCTGACGGGAAAAGCCCGGAGGACAATGCGACGTATGTTTCTTTGTT...

CDS

Download CDS FASTA

1218 bp · LXL04_037002|LXL04_037002|OH1004|CDS

ATGGGAAGAGCGTCGATAGAAACATCGAGGACATCTTCGTCGTCGTCGCCAGCGGCGGTTTCAACCACGTCTACATCGGTCACCGAGACGGTGAACGGAGAACATGATTTTAGGATTTCGGGTTACTCGTTATCGAAAGGAATTGGAATTGGGAAGTATATAGCGTCTGATACGTTTATGGTTGGTGGGTATTCATGGGCTATATATTTTTATCCTGACGGGAAAAGCCCGGAGGACAATGCGACGTATGTTTCTTTGTT...

Protein

Download Protein FASTA

405 aa · LXL04_037002|LXL04_037002|OH1004|PROTEIN

MGRASIETSRTSSSSSPAAVSTTSTSVTETVNGEHDFRISGYSLSKGIGIGKYIASDTFMVGGYSWAIYFYPDGKSPEDNATYVSLFIALASEGSDVRALFELTLLDQSGRERHKVHSHFGRALESGPYTLKYRGSMWGYKRFFKRSALETSDYLKDDCLQVHCCVGVVKSRTEGPKTYSIHVPPSDIGQQFGQLLECGKGTDVSFEVKDETFSAHKLVLAARSPVFRAQLFGPMKDQNTRCIVVEDIEPPVFKALLHFM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037002`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037002

Location Chr08:51538212-51542342 (-)

Description Similar to BPM2: BTB/POZ and MATH domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06190`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g19000`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g39760`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g03740`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g43700`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037002 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031396 regulation of protein ubiquitination Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT2G39760

ath:AT3G03740

ath:AT3G06190

ath:AT3G43700

ath:AT5G19000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.595

Rank 1 · LXL04_037002 · OH-1004

Cytoplasm0.459

Rank 2 · LXL04_037002 · OH-1004

Cell membrane0.143

Rank 3 · LXL04_037002 · OH-1004

Endoplasmic reticulum0.063

Rank 4 · LXL04_037002 · OH-1004

Extracellular0.025

Rank 5 · LXL04_037002 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22486.3MATH_235-166 aa

PF00651.38BTB192-309 aa

PF24570.2BACK_BPM_SPOP315-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037002	`PF22486.3`	MATH_2	35	166	1.9e-30	106.6
LXL04_037002	`PF00651.38`	BTB	192	309	3e-23	82.8
LXL04_037002	`PF24570.2`	BACK_BPM_SPOP	315	369	7e-28	97.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8J9`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 2	75.064%	Swiss-Prot	strong database homology
`Q8L765`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 1	74.400%	Swiss-Prot	strong database homology
`O22286`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 3	64.205%	Swiss-Prot	strong database homology
`Q9SRV1`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 4	60.665%	Swiss-Prot	strong database homology
`A1L4W5`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 6	53.883%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card