Gene Card
Gene overview
cDNA / CDS / Protein Sequences
621 bp · LXL04_036994|LXL04_036994|OH1004|cDNA
TCAATACAAAATTACAAATCTAGAAAATTGGTGGCGACTGCTTCTTCTTTTCAGGATGATCGatcatctgcttcttcttcaaAAATCATCAGAAATCCAAAAATGGGTGCCACTTCATCTGTCTACGAAAATTCATCAGTTCATGATTTCACAGTCAAGGATAGCAATGGACAGGACGTGAATCTTAGCATCTACGATGGGAAAGTTCTTCTTATCGTCAATGTTGCTTCCAAATGCCAATTTACCCAATCGAATTACAC...
594 bp · LXL04_036994|LXL04_036994|OH1004|CDS
TTGGTGGCGACTGCTTCTTCTTTTCAGGATGATCGATCATCTGCTTCTTCTTCAAAAATCATCAGAAATCCAAAAATGGGTGCCACTTCATCTGTCTACGAAAATTCATCAGTTCATGATTTCACAGTCAAGGATAGCAATGGACAGGACGTGAATCTTAGCATCTACGATGGGAAAGTTCTTCTTATCGTCAATGTTGCTTCCAAATGCCAATTTACCCAATCGAATTACACACAACTTACTGAGCTTTACAGGAAATA...
Protein
Download Protein FASTA197 aa · LXL04_036994|LXL04_036994|OH1004|PROTEIN
MVATASSFQDDRSSASSSKIIRNPKMGATSSVYENSSVHDFTVKDSNGQDVNLSIYDGKVLLIVNVASKCQFTQSNYTQLTELYRKYKDRGFVILAFPCNQFLKQEPGPIEKTVQYVCERFSAEYPIFGKVKVNGTETIPLYKYLKANGGGGYTGTSIKWNFTKFLISKKGKVIRRAGPTTEPISLEADIQKALEEP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036994 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036994 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:51440280-51441940 (+) | |||||||||
| Description | Similar to GPX4: Probable glutathione peroxidase 4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006979 response to oxidative stress Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0034599 cellular response to oxidative stress Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0012505 endomembrane system Cellular Component GO:0004601 peroxidase activity Molecular Function GO:0004602 glutathione peroxidase activity Molecular Function GO:0047066 phospholipid-hydroperoxide glutathione peroxidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G48150 ath:AT3G63080 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08534.17Redoxin35-97 aaPF00255.26GSHPx38-146 aaPF00578.28AhpC-TSA38-101 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036994 | PF08534.17 | Redoxin | 35 | 97 | 1.6e-06 | 28.7 |
| LXL04_036994 | PF00255.26 | GSHPx | 38 | 146 | 7e-38 | 129.3 |
| LXL04_036994 | PF00578.28 | AhpC-TSA | 38 | 101 | 2.3e-07 | 31.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.