LXL04_036981 | RubberDandelionOmics

Gene overview

LXL04_036981

Reference: OH-1004 Chr: Chr08 Coordinates: 51196799-51198615 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · LXL04_036981|LXL04_036981|OH1004|cDNA

ATGCTCCGGTATGCTCGACGATCACTCGCCGCTGTCCGTTACTTTTCCGCCACAGCGGTGGCGGAAGCTTCGAAACCGCCAGCTCCATCCCCCGGTGCCATAGCCACCGCCACCAGGAAAAACGTCGGTGGCGGAAAGGACACTTTAGGTCGAAGGCTTCTAAGCCTGGTTTACACGAAACGCAGCGCCGTTATCACCATAAAGAAATGGAAGGAGGAAGGACACTTAGTTCGTAAGTACGAGCTTAATCGCATAGTTCG...

CDS

Download CDS FASTA

1560 bp · LXL04_036981|LXL04_036981|OH1004|CDS

ATGCTCCGGTATGCTCGACGATCACTCGCCGCTGTCCGTTACTTTTCCGCCACAGCGGTGGCGGAAGCTTCGAAACCGCCAGCTCCATCCCCCGGTGCCATAGCCACCGCCACCAGGAAAAACGTCGGTGGCGGAAAGGACACTTTAGGTCGAAGGCTTCTAAGCCTGGTTTACACGAAACGCAGCGCCGTTATCACCATAAAGAAATGGAAGGAGGAAGGACACTTAGTTCGTAAGTACGAGCTTAATCGCATAGTTCG...

Protein

Download Protein FASTA

519 aa · LXL04_036981|LXL04_036981|OH1004|PROTEIN

MLRYARRSLAAVRYFSATAVAEASKPPAPSPGAIATATRKNVGGGKDTLGRRLLSLVYTKRSAVITIKKWKEEGHLVRKYELNRIVRELRKLKRYKHALEVCEWMTLQQDIKLLEGDYAVHLDLIAKIRGINSAEKFFEDLPDQMKGQPTCTALLHTYVQHKDSLKAEALMAKMSECGFLKYPLPFNHMMSLYISTNLLQKVPEILQELKKNTSPDIVTYNLYLTACNSQNDIITAEKIILELKRRKVDPDWVTFSLLTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036981`
TK1151 ID	TkA04G012270
OH-1004 ID	LXL04_036981
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036981

Location Chr08:51196799-51198615 (+)

Description Similar to At4g02820: Pentatricopeptide repeat-containing protein At4g02820, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02820`	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial.	No verified direct reference in this release
`At1g02150`	Pentatricopeptide repeat-containing protein At1g02150.	No verified direct reference in this release
`At1g60770`	Large ribosomal subunit protein mL101 (rPPR4).	No verified direct reference in this release
`At5g27460`	Pentatricopeptide repeat-containing protein At5g27460.	No verified direct reference in this release
`At4g01990`	Pentatricopeptide repeat-containing protein At4g01990, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036981 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000963 mitochondrial RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process

GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0140978 mitochondrial large ribosomal subunit binding Molecular Function

KEGG gene cross-reference

ath:AT1G02150

ath:AT1G60770

ath:AT4G01990

ath:AT4G02820

ath:AT5G27460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.861

Rank 1 · LXL04_036981 · OH-1004

Plastid0.071

Rank 2 · LXL04_036981 · OH-1004

Nucleus0.056

Rank 3 · LXL04_036981 · OH-1004

Cytoplasm0.038

Rank 4 · LXL04_036981 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_036981 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2186-227 aa

PF13812.13PPR_3205-264 aa

PF13041.13PPR_2215-258 aa

PF23276.3TPR_24240-347 aa

PF29070.1MSC6_N288-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036981	`PF13041.13`	PPR_2	186	227	3.1e-24	85.6
LXL04_036981	`PF13812.13`	PPR_3	205	264	1.2e-11	45.2
LXL04_036981	`PF13041.13`	PPR_2	215	258	3.1e-24	85.6
LXL04_036981	`PF23276.3`	TPR_24	240	347	2.9e-09	37.7
LXL04_036981	`PF29070.1`	MSC6_N	288	346	2.7e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY07`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial	58.523%	Swiss-Prot	strong database homology
`Q8LPS6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g02150	34.550%	Swiss-Prot	moderate database homology
`O22714`	Arabidopsis thaliana	Large ribosomal subunit protein mL101 (rPPR4)	33.713%	Swiss-Prot	moderate database homology
`Q3E911`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At5g27460	32.805%	Swiss-Prot	moderate database homology
`Q93WC5`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g01990, mitochondrial	30.409%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card