LXL04_036964 | RubberDandelionOmics

Gene overview

LXL04_036964

Reference: OH-1004 Chr: Chr08 Coordinates: 50933405-50934576 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · LXL04_036964|LXL04_036964|OH1004|cDNA

ATATAAAAAGCCCTTTGCATCACTACACGGAACTAGGGTTTACAATTCTCGCATATTAGTACTTCAGTTCCGGAGCACCAGCCGTCGAGACCTGCAATTCCGACTGCAACAATGTCGCTGGTAGCAAACGAAGATTTTCAGCACATTCTTCGTGTACAGAACACGAACGTTGATGGAAAGCAGAAGATTATGTTCGCGATGACCTCAATTAAAGGTATTGGTCGTCGTTTTGCCAACATCGTCTGCAAGAAGGCCGATGT...

CDS

Download CDS FASTA

459 bp · LXL04_036964|LXL04_036964|OH1004|CDS

ATGTCGCTGGTAGCAAACGAAGATTTTCAGCACATTCTTCGTGTACAGAACACGAACGTTGATGGAAAGCAGAAGATTATGTTCGCGATGACCTCAATTAAAGGTATTGGTCGTCGTTTTGCCAACATCGTCTGCAAGAAGGCCGATGTCGACATGAACAAGAGGGCTGGAGAACTTTCGAATGCTGAGATAGACAATCTGATGACAATTGTCGCCAATCCTCGTCAATTCAAAATCCCAGACTGGTTTTTGAACAGAAA...

Protein

Download Protein FASTA

152 aa · LXL04_036964|LXL04_036964|OH1004|PROTEIN

MSLVANEDFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIVCKKADVDMNKRAGELSNAEIDNLMTIVANPRQFKIPDWFLNRKKDYKDGKYSQVTSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036964`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036964

Location Chr08:50933405-50934576 (-)

Description Similar to RPS18A: 40S ribosomal protein S18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P34788`	Located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036964 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006413 translational initiation Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0015935 small ribosomal subunit Cellular Component

KEGG gene cross-reference

ath:AT1G22780

ath:AT1G34030

ath:AT4G09800

bbel:109466081

dre:192300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.852

Rank 1 · LXL04_036964 · OH-1004

Nucleus0.237

Rank 2 · LXL04_036964 · OH-1004

Endoplasmic reticulum0.056

Rank 3 · LXL04_036964 · OH-1004

Mitochondrion0.041

Rank 4 · LXL04_036964 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_036964 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00416.28Ribosomal_S1314-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036964	`PF00416.28`	Ribosomal_S13	14	142	4.5e-56	189.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P34788`	Arabidopsis thaliana	Small ribosomal subunit protein uS13z/uS13y/uS13x	95.395%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card