LXL04_036951 | RubberDandelionOmics

Gene overview

LXL04_036951

Reference: OH-1004 Chr: Chr08 Coordinates: 50788718-50789192 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · LXL04_036951|LXL04_036951|OH1004|cDNA

ATGGAAACTCTACAAAATACTCACGTAAAGCTGCTTGCTTTCGACTTCACATCGCTCACGCCGTCCTCATCACAACCCAAATCCGCCGTCTACCGGAGAGGCACTCTTCTCGTTTCTCGTGTGGAAACCCTAGGGATAGTCACCAGCCGAGATCACAAACCCGACAGATTCCTCCAATTCACCATCGACGATGGCACCGGGTGCATCCCCTGCGTTCTCTGGCTCAACCAGCTCACCTCCCCCTATCACTCCCGTCGAAG...

CDS

Download CDS FASTA

384 bp · LXL04_036951|LXL04_036951|OH1004|CDS

ATGGAAACTCTACAAAATACTCACGTAAAGCTGCTTGCTTTCGACTTCACATCGCTCACGCCGTCCTCATCACAACCCAAATCCGCCGTCTACCGGAGAGGCACTCTTCTCGTTTCTCGTGTGGAAACCCTAGGGATAGTCACCAGCCGAGATCACAAACCCGACAGATTCCTCCAATTCACCATCGACGATGGCACCGGGTGCATCCCCTGCGTTCTCTGGCTCAACCAGCTCACCTCCCCCTATCACTCCCGTCGAAG...

Protein

Download Protein FASTA

127 aa · LXL04_036951|LXL04_036951|OH1004|PROTEIN

METLQNTHVKLLAFDFTSLTPSSSQPKSAVYRRGTLLVSRVETLGIVTSRDHKPDRFLQFTIDDGTGCIPCVLWLNQLTSPYHSRRSPPDVRLIAESAINFATLIQIGVSARVRGKVTVYRGIATML

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036951`
TK1151 ID	TkA04G014320
OH-1004 ID	LXL04_036951
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 77.707 / OH-1004 96.063 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036951

Location Chr08:50788718-50789192 (+)

Description Similar to STN1: CST complex subunit STN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07130`	Component of the CST complex, a complex that binds to single- stranded DNA and is required to protect telomeres from DNA degradation.	STN1 protects chromosome ends in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0807867105 Role of STN1 and DNA polymerase α in telomere stability and genome-wide replication in Arabidopsis.2014 · DOI: 10.1371/journal.pgen.1004682 POT1a and components of CST engage telomerase and regulate its activity in Arabidopsis.2014 · DOI: 10.1371/journal.pgen.1004738

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036951 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016233 telomere capping Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0042162 telomeric DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.829

Rank 1 · LXL04_036951 · OH-1004

Cytoplasm0.195

Rank 2 · LXL04_036951 · OH-1004

Plastid0.028

Rank 3 · LXL04_036951 · OH-1004

Mitochondrion0.024

Rank 4 · LXL04_036951 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_036951 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01336.32tRNA_anti-codon45-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036951	`PF01336.32`	tRNA_anti-codon	45	122	1e-05	26.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMK5`	Arabidopsis thaliana	CST complex subunit STN1	50.413%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card