LXL04_036941 | RubberDandelionOmics

Gene overview

LXL04_036941

Reference: OH-1004 Chr: Chr08 Coordinates: 50514124-50517152 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_036941|LXL04_036941|OH1004|cDNA

ATGGTGGAGCACATAGAGATTTCATTTTCTACGGCCAAATATGATGAAGGTAGAGGAATAGATGTGGGACCCACTGAACCAGAAAATCCTGCAAAACCAGAGCTCAAAAACTACGAGATCGACCTTAAGGAGTGCGGGCCTATGGTCCTCGATGCACTGATTAAGATCAAAAACGAAATCGACCCTACGTTGACGTTACGTCGCTCGTGCGGTGAAGGTATCTGCGGTTTCTGTGCTATGAACATCGACGGATGTAACGG...

CDS

Download CDS FASTA

846 bp · LXL04_036941|LXL04_036941|OH1004|CDS

ATGGTGGAGCACATAGAGATTTCATTTTCTACGGCCAAATATGATGAAGGTAGAGGAATAGATGTGGGACCCACTGAACCAGAAAATCCTGCAAAACCAGAGCTCAAAAACTACGAGATCGACCTTAAGGAGTGCGGGCCTATGGTCCTCGATGCACTGATTAAGATCAAAAACGAAATCGACCCTACGTTGACGTTACGTCGCTCGTGCGGTGAAGGTATCTGCGGTTTCTGTGCTATGAACATCGACGGATGTAACGG...

Protein

Download Protein FASTA

281 aa · LXL04_036941|LXL04_036941|OH1004|PROTEIN

MVEHIEISFSTAKYDEGRGIDVGPTEPENPAKPELKNYEIDLKECGPMVLDALIKIKNEIDPTLTLRRSCGEGICGFCAMNIDGCNGLASLTKIPSGDATMITLHSDGYGGGAKLRDICQIKIKTAFGGSAKFTLPEINKLSKEVKSGSHAVLLVSYGSVCIADVQFKGRGLSQNVWESPEGSFLFSFTMQMEDGDVVPLVQYVVCLAMTEAIKDVAIRNGIPPLDVRIKWPNDLYLNGLKVGGILCASTYQSKIFNISA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036941`
TK1151 ID	TkA04G015840
OH-1004 ID	LXL04_036941
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 78.571 / OH-1004 39.146 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036941

Location Chr08:50514124-50517152 (-)

Description Similar to HCS1: Biotin--protein ligase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25710`	Plays a major role in biotin-dependent carboxylase biotinylation.	Dual targeting of Arabidopsis holocarboxylase synthetase1: a small upstream open reading frame regulates translation initiation and protein targeting.2008 · DOI: 10.1104/pp.107.111534
`At1g37150`	Seems to have no or limited implication in biotin-dependent carboxylase biotinylation in planta.	Dual targeting of Arabidopsis holocarboxylase synthetase1: a small upstream open reading frame regulates translation initiation and protein targeting.2008 · DOI: 10.1104/pp.107.111534
`At5g40650`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release
`At3g27380`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006121 mitochondrial electron transport, succinate to ubiquinone Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0042966 biotin carboxyl carrier protein biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0045273 respiratory chain complex II (succinate dehydrogenase) Cellular Component

KEGG gene cross-reference

ath:AT1G37150

ath:AT2G25710

ath:AT3G27380

ath:AT5G40650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.429

Rank 1 · LXL04_036941 · OH-1004

Nucleus0.199

Rank 2 · LXL04_036941 · OH-1004

Mitochondrion0.125

Rank 3 · LXL04_036941 · OH-1004

Peroxisome0.112

Rank 4 · LXL04_036941 · OH-1004

Endoplasmic reticulum0.106

Rank 5 · LXL04_036941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13085.12Fer2_326-104 aa

PF24663.2DUF7651130-160 aa

PF03099.25BPL_LplA_LipB155-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036941	`PF13085.12`	Fer2_3	26	104	4.9e-17	62.6
LXL04_036941	`PF24663.2`	DUF7651	130	160	2e-07	31.4
LXL04_036941	`PF03099.25`	BPL_LplA_LipB	155	265	9.8e-27	94.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL92`	Arabidopsis thaliana	Biotin--protein ligase 1, chloroplastic	63.830%	Swiss-Prot	moderate database homology
`F4I4W2`	Arabidopsis thaliana	Biotin--protein ligase 2	63.636%	Swiss-Prot	weak database homology
`Q8LB02`	Arabidopsis thaliana	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial	78.205%	Swiss-Prot	weak database homology
`Q8LBZ7`	Arabidopsis thaliana	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial	83.824%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card