LXL04_036914 | RubberDandelionOmics

Gene overview

LXL04_036914

Reference: OH-1004 Chr: Chr08 Coordinates: 50001519-50002362 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · LXL04_036914|LXL04_036914|OH1004|cDNA

ATGGCATCCATCTCCATTTCCACTTCCACTGTTCTCCCCAAGAGACCTTCCACTCTTCATGGGTTACCAGCACTGCACCAAATAGGAAGAGTGAGATGTTTGATTGAAAATTGTACGAAAAATGAGAACAAGTCACGATTGGTGATGACAAGTGTGTCGTCATTGGCTACTACAACGATGGTTGCAGCCATGTCAAGTCCAATTGCTATGGCTCTGGTGGATGAGAGAATGAGCACGGAAGGGACTGGGCTGCCCTTTGG...

CDS

Download CDS FASTA

378 bp · LXL04_036914|LXL04_036914|OH1004|CDS

ATGGCATCCATCTCCATTTCCACTTCCACTGTTCTCCCCAAGAGACCTTCCACTCTTCATGGGTTACCAGCACTGCACCAAATAGGAAGAGTGAGATGTTTGATTGAAAATTGTACGAAAAATGAGAACAAGTCACGATTGGTGATGACAAGTGTGTCGTCATTGGCTACTACAACGATGGTTGCAGCCATGTCAAGTCCAATTGCTATGGCTCTGGTGGATGAGAGAATGAGCACGGAAGGGACTGGGCTGCCCTTTGG...

Protein

Download Protein FASTA

125 aa · LXL04_036914|LXL04_036914|OH1004|PROTEIN

MASISISTSTVLPKRPSTLHGLPALHQIGRVRCLIENCTKNENKSRLVMTSVSSLATTTMVAAMSSPIAMALVDERMSTEGTGLPFGLSNNLLGWILFAVFGLIWTFYFAYTGSLDEDDDSGLSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036914`
TK1151 ID	TkA04G017720
OH-1004 ID	LXL04_036914
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 71.901 / OH-1004 69.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036914

Location Chr08:50001519-50002362 (-)

Description Similar to PSBW: Photosystem II reaction center W protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30570`	Stabilizes dimeric photosystem II (PSII).	The low molecular mass PsbW protein is involved in the stabilization of the dimeric photosystem II complex in Arabidopsis thaliana.2000 · DOI: 10.1074/jbc.m006300200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0773700`	Stabilizes dimeric photosystem II (PSII).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036914 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0042549 photosystem II stabilization Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT2G30570

dosa:Os01g0773700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · LXL04_036914 · OH-1004

Mitochondrion0.017

Rank 2 · LXL04_036914 · OH-1004

Nucleus0.016

Rank 3 · LXL04_036914 · OH-1004

Cytoplasm0.009

Rank 4 · LXL04_036914 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_036914 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07123.18PsbW14-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036914	`PF07123.18`	PsbW	14	125	9.3e-43	146.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39194`	Arabidopsis thaliana	Photosystem II reaction center W protein, chloroplastic	58.394%	Swiss-Prot	strong database homology
`Q5ZBY9`	Oryza sativa subsp. japonica	Photosystem II reaction center W protein, chloroplastic	50.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card