LXL04_036820 | RubberDandelionOmics

Gene overview

LXL04_036820

Reference: OH-1004 Chr: Chr08 Coordinates: 48807984-48809445 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_036820|LXL04_036820|OH1004|cDNA

ATGGATGTTACTCTTGGCTTGTTAGGTAATTCTCCGGGAGGTGAcgatggtggcggtggtggtggagtGCCGTCTGGTGGGTCGACCACCGCTAGGTCAATATTGACAGTATCGAAGGAAGATAACAAGAACAGATTGGTTATGTCTGCTGAGGTTACTTCTTCTTACCCTGTTGATGAAAATTCAGATGATCTTGAATTGGGACTCGGGTTGAGTAtcggcggcggtggtggtggtttgAAGTCAAAAGCGGTGGTTGG...

CDS

Download CDS FASTA

927 bp · LXL04_036820|LXL04_036820|OH1004|CDS

ATGGATGTTACTCTTGGCTTGTTAGGTAATTCTCCGGGAGGTGACGATGGTGGCGGTGGTGGTGGAGTGCCGTCTGGTGGGTCGACCACCGCTAGGTCAATATTGACAGTATCGAAGGAAGATAACAAGAACAGATTGGTTATGTCTGCTGAGGTTACTTCTTCTTACCCTGTTGATGAAAATTCAGATGATCTTGAATTGGGACTCGGGTTGAGTATCGGCGGCGGTGGTGGTGGTTTGAAGTCAAAAGCGGTGGTTGG...

Protein

Download Protein FASTA

308 aa · LXL04_036820|LXL04_036820|OH1004|PROTEIN

MDVTLGLLGNSPGGDDGGGGGGVPSGGSTTARSILTVSKEDNKNRLVMSAEVTSSYPVDENSDDLELGLGLSIGGGGGGLKSKAVVGGPCWGQYARILTAKDFPSLVSKPNSSSSSSSVNIPNSSTSGTKRTAADSVSPPNGTSVVGWPPVSKAHRIPSLANNSKLQTDELISTPEEIKNKNKSNGVQEYSGEKRNAIPFKKYRSVKVNMDGTLIGRKVDLNAHTSYETLAQTLEEMFWGRRSIKEGGSSKLLDGTSEFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036820`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036820

Location Chr08:48807984-48809445 (-)

Description Similar to IAA12: Auxin-responsive protein IAA12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04550`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At2g33310`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At4g28640`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XB18`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`Os02g0817600`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036820 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G04550

ath:AT2G33310

ath:AT4G28640

dosa:Os02g0817600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · LXL04_036820 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_036820 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_036820 · OH-1004

Endoplasmic reticulum0.035

Rank 4 · LXL04_036820 · OH-1004

Plastid0.016

Rank 5 · LXL04_036820 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309.23AUX_IAA116-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036820	`PF02309.23`	AUX_IAA	116	297	1.9e-46	159.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38830`	Arabidopsis thaliana	Auxin-responsive protein IAA12	46.667%	Swiss-Prot	moderate database homology
`Q38831`	Arabidopsis thaliana	Auxin-responsive protein IAA13	45.413%	Swiss-Prot	moderate database homology
`Q38829`	Arabidopsis thaliana	Auxin-responsive protein IAA11	41.729%	Swiss-Prot	moderate database homology
`A2XB18`	Oryza sativa subsp. indica	Auxin-responsive protein IAA10	42.692%	Swiss-Prot	moderate database homology
`Q0DWF2`	Oryza sativa subsp. japonica	Auxin-responsive protein IAA10	42.692%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card